Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate Echvi_2204 Echvi_2204 ABC-type antimicrobial peptide transport system, ATPase component
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__Cola:Echvi_2204 Length = 240 Score = 138 bits (347), Expect = 1e-37 Identities = 81/203 (39%), Positives = 122/203 (60%), Gaps = 4/203 (1%) Query: 36 LRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQVDGIDLA-ATTREAAQV 94 L+ + + + +GE + GPSGSGKSTL+ I L+ G+ ++ D++ T E A++ Sbjct: 24 LKSVTIDIIKGEYVAFMGPSGSGKSTLMNIIGCLDTPTAGNYILNNKDVSHMTENELAEI 83 Query: 95 RS-DIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEERARMYLSKVGIESQAHKYP 153 R+ +IG VFQ FNL P + L+N L P G S+ D E++A + L VG+E + H P Sbjct: 84 RNKEIGFVFQTFNLLPRATCLENVAL-PLIYAGYSKSDREDKAFLALKSVGLEDRIHHKP 142 Query: 154 SQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEVLDVLVQLAGTGMTMLCVTH 213 ++LSGGQ+QRVAIARAL P I+L DEPT LD + +++++ +L G T++ VTH Sbjct: 143 NELSGGQRQRVAIARALVNDPSIILADEPTGNLDTKTSYDIMNLFDELHQKGNTIIMVTH 202 Query: 214 EMGFARQVAERVLFLEGGQIIED 236 E A A R++ L G + D Sbjct: 203 EDDIA-HYAHRIVRLRDGLVETD 224 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 240 Length adjustment: 24 Effective length of query: 236 Effective length of database: 216 Effective search space: 50976 Effective search space used: 50976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory