Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109) (characterized)
to candidate Echvi_2951 Echvi_2951 Electron transfer flavoprotein, beta subunit
Query= BRENDA::D2RIQ2 (263 letters) >FitnessBrowser__Cola:Echvi_2951 Length = 245 Score = 106 bits (265), Expect = 4e-28 Identities = 75/207 (36%), Positives = 110/207 (53%), Gaps = 14/207 (6%) Query: 1 MNIVVCVKQVPDTAEMKIDPVTNNLVRD--GVTNIMNPYDQYALETALQLKDELGAHVTV 58 M I+VC+ VPDT KI NN D GV I+ PYD YAL A++L+D+ +TV Sbjct: 1 MKILVCITHVPDTTS-KIQFTDNNTKFDKTGVQFIIGPYDDYALARAVELRDQSSGSLTV 59 Query: 59 ITMGPPHAESVLRDCLAVGADEAKLVSDRAFGGADTLATSAAMANTIKHF---GVPDLIL 115 + +G E LR LA+GAD+A V+ AF + S +AN I H+ G DLIL Sbjct: 60 LNVGEAETEPTLRKALAIGADDAIRVN--AFP-----SDSLFVANQIAHYAKEGGYDLIL 112 Query: 116 CGRQAIDGDTAQVGPEIAEHLGLPQVTAALKVQVKDDTVVVDRDNEQMSMTFTMKMPCVV 175 GR++ID + V +AE LG+P V+ +K+ ++ DT + R+ E +K+P V Sbjct: 113 MGRESIDFNGGMVHGMVAEMLGIPSVSPVMKLDLEGDTAKIAREIEGGKEHLEVKLPFVA 172 Query: 176 TVMRS-KDLRFASIRGKMKARKAEIPV 201 + + ++RG M AR + V Sbjct: 173 GCQEPIAEWKIPNMRGIMSARSKPLNV 199 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 245 Length adjustment: 24 Effective length of query: 239 Effective length of database: 221 Effective search space: 52819 Effective search space used: 52819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory