Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate Echvi_2990 Echvi_2990 Acyl-CoA dehydrogenases
Query= BRENDA::B0EVL5 (395 letters) >FitnessBrowser__Cola:Echvi_2990 Length = 402 Score = 403 bits (1035), Expect = e-117 Identities = 201/386 (52%), Positives = 266/386 (68%) Query: 8 FDWADPLYLDSQLTDTERMVRDSARAYSQERLLPRVQEAFRHEKTDRAIFNEMGELGLLG 67 F+ D LD T ++R S R + ++ + P ++E + I + GE+G G Sbjct: 16 FEGVDFYGLDDLFTAEHLLIRQSLRDFVKKEVSPYIEEWAQDAHFPSEIVPKFGEIGAFG 75 Query: 68 ATIPEQYGGSGMNYVCYGLIAREVERVDSGYRSMMSVQSSLVMVPINEFGSEETKQKYLP 127 IP +YGG G++Y+ YGLI +E+ER DSG RS +SVQ SLVM PI+ FGSEE ++K+LP Sbjct: 76 PQIPAKYGGGGLDYISYGLIMQEIERGDSGMRSTVSVQGSLVMYPIHAFGSEEQREKFLP 135 Query: 128 KLATGEWVGCFGLTEPNHGSDPGSMVTRARKVDGGYSLSGAKMWITNSPIADVFVVWAKD 187 KLA+GEW+GCFGLTEP+HGS+PG + T + Y L+GAKMWI+N+P AD+ VVWAKD Sbjct: 136 KLASGEWLGCFGLTEPDHGSNPGGLTTSFKDNGDHYLLNGAKMWISNAPEADIAVVWAKD 195 Query: 188 DAGDIRGFVLEKGWKGLSAPAIHGKVGLRASITGEIVMDEVFCPEENAFPTVRGLKGPFT 247 + G I G ++E+G +G + P H K LRAS TGE+V D V P+EN P GL P Sbjct: 196 ENGRIHGLIVERGMEGFTTPTTHHKWSLRASCTGELVFDNVKVPKENLLPGKSGLSAPLM 255 Query: 248 CLNSARYGIAWGALGAAEACYETARQYTMDRKQFGRPLAANQLIQKKLADMLTEITLGLQ 307 CL++ARYGIAWGA+GAA CYE+A++Y M+R QF +P+AA QL+QKKLA+MLTEIT Sbjct: 256 CLDAARYGIAWGAIGAAMDCYESAKRYAMERIQFDKPIAAFQLVQKKLAEMLTEITKAQL 315 Query: 308 GCLRLGRLKDEGNAPVELTSIMKRNSCGKSLDIARVARDMLGGNGISDEFCIARHLVNLE 367 RLG LKD+G A S+ KRN+ +L+IAR AR + GG GI+ ++ I RH++NLE Sbjct: 316 LAWRLGTLKDQGKATSAQISMAKRNNVAMALEIAREARQIHGGMGITGDYPIMRHMMNLE 375 Query: 368 VVNTYEGTHDIHALILGRAITGLAAF 393 V TYEGTHDIH LILG+ ITG+ AF Sbjct: 376 SVITYEGTHDIHLLILGQEITGIPAF 401 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 402 Length adjustment: 31 Effective length of query: 364 Effective length of database: 371 Effective search space: 135044 Effective search space used: 135044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory