Align isobutyryl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate Echvi_2990 Echvi_2990 Acyl-CoA dehydrogenases
Query= reanno::WCS417:GFF2713 (383 letters) >FitnessBrowser__Cola:Echvi_2990 Length = 402 Score = 239 bits (610), Expect = 1e-67 Identities = 134/373 (35%), Positives = 204/373 (54%), Gaps = 5/373 (1%) Query: 6 YTEEQVMIRDMARDFARGEIAPYAQAWEKAGWIDDALVAKMGELGLLGMVVPEEWGGTYV 65 +T E ++IR RDF + E++PY + W + +V K GE+G G +P ++GG + Sbjct: 28 FTAEHLLIRQSLRDFVKKEVSPYIEEWAQDAHFPSEIVPKFGEIGAFGPQIPAKYGGGGL 87 Query: 66 DYVAYALAVEEISAGDGATGALMSIHNSVGCGPILNYGTESQKQTWLADLASGQAIGCFC 125 DY++Y L ++EI GD + +S+ S+ PI +G+E Q++ +L LASG+ +GCF Sbjct: 88 DYISYGLIMQEIERGDSGMRSTVSVQGSLVMYPIHAFGSEEQREKFLPKLASGEWLGCFG 147 Query: 126 LTEPQAGSEAHNLRTRAELRDGHWVITGAKQFVSNGKRAKLAIVFAITDPELGKKGISAF 185 LTEP GS L T + H+++ GAK ++SN A +A+V+A E G+ I Sbjct: 148 LTEPDHGSNPGGLTTSFKDNGDHYLLNGAKMWISNAPEADIAVVWA--KDENGR--IHGL 203 Query: 186 LVPTATPGFVVDRTEHKMGIRASDTCAVTLNQCTVPEANLLGERGKGLAIALSNLEGGRI 245 +V GF T HK +RAS T + + VP+ NLL + GL+ L L+ R Sbjct: 204 IVERGMEGFTTPTTHHKWSLRASCTGELVFDNVKVPKENLLPGK-SGLSAPLMCLDAARY 262 Query: 246 GIAAQALGIARAAFEAALAYARDRVQFDKAIIEHQSVANLLADMQTQLNAARLLILHAAR 305 GIA A+G A +E+A YA +R+QFDK I Q V LA+M T++ A+LL Sbjct: 263 GIAWGAIGAAMDCYESAKRYAMERIQFDKPIAAFQLVQKKLAEMLTEITKAQLLAWRLGT 322 Query: 306 LRSAGKPCLSEASQAKLFASEMAEKVCSSAMQIHGGYGYLEDYPVERYYRDARITQIYEG 365 L+ GK ++ S AK MA ++ A QIHGG G DYP+ R+ + YEG Sbjct: 323 LKDQGKATSAQISMAKRNNVAMALEIAREARQIHGGMGITGDYPIMRHMMNLESVITYEG 382 Query: 366 TSEIQRMVIAREL 378 T +I +++ +E+ Sbjct: 383 THDIHLLILGQEI 395 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 402 Length adjustment: 31 Effective length of query: 352 Effective length of database: 371 Effective search space: 130592 Effective search space used: 130592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory