Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate Echvi_3653 Echvi_3653 ABC-type sulfate/molybdate transport systems, ATPase component
Query= reanno::pseudo6_N2E2:Pf6N2E2_2050 (263 letters) >FitnessBrowser__Cola:Echvi_3653 Length = 290 Score = 130 bits (326), Expect = 4e-35 Identities = 84/234 (35%), Positives = 133/234 (56%), Gaps = 16/234 (6%) Query: 14 LDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIMLD 73 +D++ K GP L + L++ +G +TL G SGSGKT+ LR ++ L G + ++ Sbjct: 4 IDLQKSLKANGPAMDLD-IKLTISQGEFITLFGPSGSGKTSTLRMISGLLTPDKGHLSVN 62 Query: 74 GESIGYDDIDGKRVRHPEKVIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLPKD 133 GE +D GK V + R G FQ ++LFP++T +N+ L K KD Sbjct: 63 GEQ-WFDASFGKNV-------SPGRRKLGYLFQDYSLFPNMTVKENIAFAL----KNAKD 110 Query: 134 EAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPEL 193 +A + + LE +GLL +D P LSGGQQQRVA+ARA+A+ P ++L DE SALDP + Sbjct: 111 KAYLM--ELLESMGLLHLQDTLPKHLSGGQQQRVALARALALKPDILLLDEPLSALDPSM 168 Query: 194 VGEVLNVIKGL-AEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELF 246 ++ I + + +T +LV+H+ ++SD+I+ ++ G++ Q PKE F Sbjct: 169 REKLQEYILAIHRKYALTTILVSHDAGEIIKLSDRIIELDHGKVLRQCTPKEFF 222 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 290 Length adjustment: 25 Effective length of query: 238 Effective length of database: 265 Effective search space: 63070 Effective search space used: 63070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory