Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)
to candidate Echvi_4044 Echvi_4044 ABC-type transport system involved in resistance to organic solvents, ATPase component
Query= reanno::pseudo3_N2E3:AO353_16275 (244 letters) >FitnessBrowser__Cola:Echvi_4044 Length = 249 Score = 134 bits (338), Expect = 1e-36 Identities = 79/227 (34%), Positives = 133/227 (58%), Gaps = 3/227 (1%) Query: 1 MISIKNVNKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVVV 60 ++ ++ + K +G+ VL ++ KGE +VV G SG+GKS LIK + L +G + V Sbjct: 5 VVEVRGLKKSFGELDVLMGVDLDLYKGENVVVLGKSGTGKSVLIKIMVGLLTQDEGTMNV 64 Query: 61 DGTSIAD-PKTDLPKLRSRVGMVFQHFELFPHLTITENLTIAQIK-VLGRSKEEATKKGL 118 G +++ DL +LR ++G FQ L+ +T+ ENL ++ V G S+ E K Sbjct: 65 LGKEVSNLGAKDLNELRLKIGFSFQASALYDSMTVRENLEFPLVRNVKGLSRTEKDKMVE 124 Query: 119 QLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDV 178 ++LE VGLS ++ P +LSGGQ++R+ IAR L + P +ML+DEPT+ LDP +++ ++ Sbjct: 125 EVLEAVGLSQTINQMPSELSGGQRKRIGIARTLILKPEIMLYDEPTAGLDPITCSDINNL 184 Query: 179 MVQL-ANEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFF 224 + ++ N + + +TH++ AR DRV + G+ + K EE F Sbjct: 185 INEVRENYNTSSIIITHDLTCARDTGDRVAVLLDGQFGAEGKFEEVF 231 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 249 Length adjustment: 24 Effective length of query: 220 Effective length of database: 225 Effective search space: 49500 Effective search space used: 49500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory