Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate Echvi_4044 Echvi_4044 ABC-type transport system involved in resistance to organic solvents, ATPase component
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >FitnessBrowser__Cola:Echvi_4044 Length = 249 Score = 140 bits (354), Expect = 2e-38 Identities = 79/252 (31%), Positives = 147/252 (58%), Gaps = 17/252 (6%) Query: 11 QPLLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRC-VNMLEEFQGGQ 69 + ++++RGL+K +G L+VL GVDL + +G V ++G SG+GK+ L++ V +L + +G Sbjct: 3 EKVVEVRGLKKSFGELDVLMGVDLDLYKGENVVVLGKSGTGKSVLIKIMVGLLTQDEGTM 62 Query: 70 IVLDGE--SIGYDDIDGKRVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLK- 126 VL E ++G D++ R++ G +FQ L+ +T +N+ L++ Sbjct: 63 NVLGKEVSNLGAKDLNELRLK------------IGFSFQASALYDSMTVRENLEFPLVRN 110 Query: 127 VKKLPKDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVT 186 VK L + E + E+ LE VGL + + P +LSGGQ++R+ IAR + + P +ML+DE T Sbjct: 111 VKGLSRTEKDKMVEEVLEAVGLSQTINQMPSELSGGQRKRIGIARTLILKPEIMLYDEPT 170 Query: 187 SALDPELVGEVLNVIKGLAED-GMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKEL 245 + LDP ++ N+I + E+ + +++TH++ A + D++ + G+ +G +E+ Sbjct: 171 AGLDPITCSDINNLINEVRENYNTSSIIITHDLTCARDTGDRVAVLLDGQFGAEGKFEEV 230 Query: 246 FERPQSPRLAEF 257 F+ P+ R+ F Sbjct: 231 FKTPEDQRVKSF 242 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 249 Length adjustment: 24 Effective length of query: 239 Effective length of database: 225 Effective search space: 53775 Effective search space used: 53775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory