Align cyclohexa-1,5-dienecarbonyl-CoA hydratase monomer (EC 4.2.1.100) (characterized)
to candidate Echvi_4069 Echvi_4069 Enoyl-CoA hydratase/carnithine racemase
Query= metacyc::MONOMER-18320 (256 letters) >FitnessBrowser__Cola:Echvi_4069 Length = 261 Score = 114 bits (284), Expect = 3e-30 Identities = 82/268 (30%), Positives = 134/268 (50%), Gaps = 34/268 (12%) Query: 6 ILFEKKDKVATITLNVPNS-NWLTIPMMKEINEALMDVKKDPTIQLLVFDHAGDKAFCDG 64 IL E KD + +T+N + N + ++E+ +V + +I+ +V +G+KAF G Sbjct: 7 ILSENKDGILYLTINRESKLNAINFDTLEELKNIFNEVSDNKSIRGVVLTGSGEKAFVAG 66 Query: 65 VDVAD----------HVPEKVDEMIDLFHGMFRNMAAMDVTSVCLVNGRSLGGGCELMAF 114 D+++ E E+ L + + A+ VNG +LGGGCEL Sbjct: 67 ADISEIAELNELNARKFSENGQEVFSLIESCHKPVIAV-------VNGFALGGGCELSMA 119 Query: 115 CDIVIASEKAKIGQPEINLAVFPPVAAAW-FPKIMGLKKAMELILTGKIISAKEAEAIGL 173 C + IA+ AK GQPE+NL + P ++G KA EL++TG ++ A EA+A+GL Sbjct: 120 CHMRIATSNAKFGQPEVNLGIIPGYGGTQRLTFLIGRTKANELLMTGDMVDAAEAKALGL 179 Query: 174 VNVVLPVEGFREAAQKFMADFTSKSRPVAMWARRAIMAGLNLDFLQALKAS-------EI 226 VN V + EA QK ++ + + + G+ +D + A+ ++ E Sbjct: 180 VNYVTQTKA--EAIQK------AEEILQKIMTKAPLSIGMIIDCVNAVYSNDENGYLIEA 231 Query: 227 IYMQGCMATEDANEGLASFLEKRKPVFK 254 C+ +ED +EG ++FLEKRKP FK Sbjct: 232 NSFARCVKSEDYSEGTSAFLEKRKPNFK 259 Lambda K H 0.322 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 261 Length adjustment: 24 Effective length of query: 232 Effective length of database: 237 Effective search space: 54984 Effective search space used: 54984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory