Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate GFF1006 PGA1_c10230 glucosamine--fructose-6-phosphate aminotransferase GlmS
Query= reanno::Korea:Ga0059261_1644 (347 letters) >FitnessBrowser__Phaeo:GFF1006 Length = 602 Score = 142 bits (358), Expect = 2e-38 Identities = 109/351 (31%), Positives = 173/351 (49%), Gaps = 27/351 (7%) Query: 14 MEREAAEAGAAVSRMLAA--NRDAIERVAARLRASPPAVVVTCARGSSDHAATYAKYLIE 71 M +E AE A+ R L A D + A L + + A G++ +A AKY Sbjct: 252 MAKEIAEQPVAIDRALKAYMGDDGQLSLPAELDFTKIERLTMVACGTAFYACMVAKYWFG 311 Query: 72 TLTGVPTASAALSVAS--LYDAPVAPGNGLCLAISQSGKSPDLLATVEHQRKAGAFVVAM 129 + +P + VAS Y P P L L +SQSG++ D LA + + +V + Sbjct: 312 QIARMPVE---VDVASEFRYREPPVPEKTLALFVSQSGETADTLAALRYMEGKAQQIVGL 368 Query: 130 VNAEDSPLAALADIVIPLKAGPERSVAATKSYICSLAAIAALVAAWAQDEAL---ETAVA 186 VN +S +A +D+++PL AGPE SVA+TK++ C L+ + L A+ L + A Sbjct: 369 VNVPESSIARESDVILPLHAGPEISVASTKAFTCQLSILLLLALRAAEQRGLPLPDGMPA 428 Query: 187 D---LPAQLERAFALD--WSAAVTALTGASGLFVLGRGYGYGIAQEAALKFKETCALHAE 241 D LP + ++ A + +A+ L A + LGRG Y +A E ALK KE +HAE Sbjct: 429 DLRALPGLIHQSLAAEKQITASARGLAEARDIIFLGRGQLYPLALEGALKLKELSYIHAE 488 Query: 242 SFSAAEVRHGPMAIVGEAFHVLAFASSDRAGESVRETVAEFRSRGAEVLLADPA--ARQA 299 +++ E++HGP+A++ E V+ A D + + E +RG +V+L A A+ A Sbjct: 489 GYASGELKHGPIALIDEKVPVVVMAPRDALFDKTVSNMQEVMARGGKVILITDAEGAKIA 548 Query: 300 G--------LPAIAAHPAIEPILIVQSFYKMANALALARGCDPDSPPHLNK 342 G +P + ++ PIL ++A A+A+G D D P +L K Sbjct: 549 GDGTHEVIVMPQVP--DSLAPILYAVPAQQIAYYTAIAKGTDVDQPRNLAK 597 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 602 Length adjustment: 33 Effective length of query: 314 Effective length of database: 569 Effective search space: 178666 Effective search space used: 178666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory