Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate GFF1218 PGA1_c12340 Predicted acyl-CoA transferases/carnitine dehydratase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__Phaeo:GFF1218 Length = 406 Score = 380 bits (976), Expect = e-110 Identities = 194/382 (50%), Positives = 259/382 (67%), Gaps = 6/382 (1%) Query: 2 GALSHLRVLDLSRVLAGPWAGQILADLGADVIKVERP-GNGDDTRAWGPPFLKDARGENT 60 G L+ ++VLDLSR+LAGP Q+L DLGA V+KVE P GDDTR WGPP++ DA G+ + Sbjct: 15 GPLTGIKVLDLSRILAGPTCTQMLGDLGASVLKVENPQSGGDDTRQWGPPYVIDAEGQQS 74 Query: 61 TEAAYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKA 120 +AY+++ANRNK+SV +D + EGQ+++R LAA +DIL+ENFK GGLA YGLDYDSL A Sbjct: 75 DLSAYFMAANRNKRSVEVDISTVEGQQVIRRLAADADILLENFKPGGLAKYGLDYDSLHA 134 Query: 121 INPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDI 180 P L+Y SI+G+GQTGP A++ GYD M QG GG+MSLTG P+G P+KVGV + D+ Sbjct: 135 EFPHLVYGSISGYGQTGPNAQKPGYDLMAQGYGGIMSLTGEPDG----RPMKVGVGIADV 190 Query: 181 LTGLYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHP 240 + G+Y+ ILAAL +++ G GQ +D+AL+D Q+A L N+ + L TG APKR GN HP Sbjct: 191 MCGMYACVGILAALRYKEQTGEGQQVDIALVDAQIAWLINEGVATLNTGTAPKRRGNEHP 250 Query: 241 NIVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLI 300 +IVPY + T+DG IL VGND QF +F G A DPRFATN R+ NR L ++ Sbjct: 251 SIVPYGLYETSDGHVILAVGNDAQFGRFLSFLGLDGLARDPRFATNPARLQNRDALADIL 310 Query: 301 RQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVAS 360 A +T + +E VP GP+ L QVFA Q+ AR + +E+ AG V + + Sbjct: 311 VPALRQYSTDAVIAAMEARKVPAGPVQTLDQVFATDQIAAREMTIEMTS-AAGPVRLLGN 369 Query: 361 PIRLSETPVEYRNAPPLLGEHT 382 P++ S TPV YR+APP G+ T Sbjct: 370 PLKFSRTPVTYRHAPPTCGDST 391 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 406 Length adjustment: 31 Effective length of query: 375 Effective length of database: 375 Effective search space: 140625 Effective search space used: 140625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory