Align N-Acetyl-D-glucosamine ABC transport system, permease component 2 (characterized)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component
Query= reanno::Phaeo:GFF2752 (280 letters) >FitnessBrowser__Phaeo:GFF1646 Length = 283 Score = 149 bits (376), Expect = 7e-41 Identities = 85/280 (30%), Positives = 149/280 (53%), Gaps = 6/280 (2%) Query: 5 SRSNPFNSILAHG---ALITYTLIALFPVFVILVNSFKTRKAIFRDPLG-LPTSDTFSLV 60 +RS+ + LA G A+ Y ALFP++ ++ + IF + LP++ TF Sbjct: 5 ARSSSRHPALAFGKYAAIAFYLGFALFPLYWLMKIAITPDALIFSEGTRMLPSAVTFE-- 62 Query: 61 GYQTVLKQGDFFLYFQNSMIVTVVSLALVLLFGAMAAFALAEYRFKGNMLLGLYLALGIM 120 + TVL + +F YF+NS+ V++ + L A A +A + + F G ++ + + M Sbjct: 63 NFATVLFETEFLAYFRNSLTVSLGTAFFTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQM 122 Query: 121 IPIRIGTVAILELMVDTGLVNTLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGRID 180 P+ + I +++ D GL+N+LT+LI+VYTA +P A F++ F + DL+ A +D Sbjct: 123 FPLLMIIAPIYKIVADLGLLNSLTSLIVVYTAFNIPFATFLMQSFFDGIPKDLEEAAMMD 182 Query: 181 GLSEYTIFFRLVLPLVRPAMATVAVFNMIPIWNDLWFPLILAPAEETKTLTLGSQVFIGQ 240 G S + +V PL P + F W++L F L+L + T +G F+ + Sbjct: 183 GCSRFQALRTVVFPLTLPGLGATLGFVFTAAWSELLFALMLISKNDAMTFPVGLLTFVSK 242 Query: 241 FVTDWNAVLSALSMAILPVMVLYVIFSRQLIRGITSGAVK 280 F DW +++A +A++P + ++ R L++G+TSGAVK Sbjct: 243 FSVDWGQMMAAGVLALVPSCLFFIFIQRYLVQGLTSGAVK 282 Lambda K H 0.330 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 283 Length adjustment: 26 Effective length of query: 254 Effective length of database: 257 Effective search space: 65278 Effective search space used: 65278 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory