Align ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized)
to candidate GFF1916 PGA1_c19480 ABC transporter, inner-membrane protein
Query= reanno::Smeli:SMc03063 (380 letters) >FitnessBrowser__Phaeo:GFF1916 Length = 297 Score = 146 bits (369), Expect = 6e-40 Identities = 82/224 (36%), Positives = 127/224 (56%), Gaps = 9/224 (4%) Query: 158 LSAAGIGRSFLNSLTVAVPSTVIPILIAAFAAYALAWMPFPGRAVLLAVVVGLLVVPLQM 217 L GI F NS+ + +PS V+ I A Y L + F G + A+++ VP Q Sbjct: 81 LQCEGIKVGFWNSMRILLPSLVVSITAGALCGYILTFWTFRGAEIFFAILLFGAFVPYQA 140 Query: 218 SLIPLLQLYNGVGAFFGVSAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVD 277 + P++++++ G + T GI L HT FGLP+ + RNY + LP EI ++ARVD Sbjct: 141 LIFPMIRIFSATGLY-----GTLPGIVLVHTIFGLPIMTLIFRNYYSTLPSEIFKAARVD 195 Query: 278 GASDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGDDKLVLTGRLVNLLG 337 GA F +F ++LP+S P + AI Q WND L+ ++F G + + +T +L N++ Sbjct: 196 GAGFFSVFWYVLLPISTPIIVVAAILQVTGIWNDYLLGLIF--GGRENMPMTVQLNNIVN 253 Query: 338 S-RGG-NWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKG 379 S RGG + + A+ +T +VPL V+F R+ VRG+ AG+VKG Sbjct: 254 SVRGGKEYNVNMAATLLTALVPLTVYFVSGRWFVRGIAAGAVKG 297 Lambda K H 0.324 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 297 Length adjustment: 28 Effective length of query: 352 Effective length of database: 269 Effective search space: 94688 Effective search space used: 94688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory