Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Asp/Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate GFF2166 PGA1_c21980 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
Query= curated2:A8LJ24 (95 letters) >FitnessBrowser__Phaeo:GFF2166 Length = 95 Score = 150 bits (379), Expect = 3e-42 Identities = 78/95 (82%), Positives = 83/95 (87%) Query: 1 MSIDIETARRVAKLARIKVEDDALPALAGEFNHILGFIEQLNEVDVDDVEPMTSVTPMRL 60 MSID TA +VAKLARIKVE+DALPALA EFN ILGFIEQLNEVDV+ VEPMTSVTP RL Sbjct: 1 MSIDQSTAAKVAKLARIKVEEDALPALADEFNTILGFIEQLNEVDVEGVEPMTSVTPQRL 60 Query: 61 KRREDVVTDGDQQAAVLSNAPDAREGFFAVPKVVE 95 KRR D VTDG QQ +L+NAPDAREGFFAVPKVVE Sbjct: 61 KRRVDEVTDGSQQDKILANAPDAREGFFAVPKVVE 95 Lambda K H 0.317 0.135 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 83 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 95 Length of database: 95 Length adjustment: 10 Effective length of query: 85 Effective length of database: 85 Effective search space: 7225 Effective search space used: 7225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 39 (19.6 bits)
Align candidate GFF2166 PGA1_c21980 (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.17121.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.17121.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.