Align Fructose import permease protein FrcC (characterized)
to candidate GFF2275 PGA1_c23070 putative ribose transport system permease protein
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__Phaeo:GFF2275 Length = 333 Score = 138 bits (348), Expect = 2e-37 Identities = 100/313 (31%), Positives = 160/313 (51%), Gaps = 24/313 (7%) Query: 55 LVLSLIAFGVILGGKFFS----AF----TMTLILQQVAIVGIVGAAQTLVILTAGIDLSV 106 +VL LI F V G+FFS AF M L+L+Q A +GI+ T+V++ IDLSV Sbjct: 19 IVLELIFFSV--AGEFFSVSDKAFMDTDNMLLLLKQSAPIGIIAMGMTIVMVNGNIDLSV 76 Query: 107 GAIMVLSSVIM------GQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIV 160 GAI + ++I+ F + ++ L G + G ING +V + + FIV Sbjct: 77 GAIYAICAIILLDSMTWTMFAGLGNWVIPVAWCLALLTGVVLGAINGLIVWKTGVDAFIV 136 Query: 161 TLGMWQIVLASNFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCL 220 TLG F+Y+ + N +++ F F +G T+ ++V+ + + Sbjct: 137 TLGSMLGYRGLVFMYNGEQPTS----HLNWTLVDFAEAQF-LGLHTATWFLLVVTVAI-- 189 Query: 221 LWYVLNRTAWGRYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSV 280 W+++NRT GR YA+G++ EAA AG+ V ++ + + G + AL+ GSV Sbjct: 190 -WFLMNRTVHGRNAYAIGNNREAAVNAGIRVGPHMMINFMIIGFLAALSAVVFYSESGSV 248 Query: 281 SPTAGQFANIESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLL 340 +P GQ + ITAVV+GG L GG GSI+ G + + + GL +G D L+ Sbjct: 249 NPNDGQLYELWVITAVVLGGTKLTGGAGSIVSTFGGVIAIQLLRKGLAHIGADTSTVNLV 308 Query: 341 IGLLIIIAVAIDQ 353 IGL++I + +D+ Sbjct: 309 IGLILIAVLFLDR 321 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 333 Length adjustment: 29 Effective length of query: 331 Effective length of database: 304 Effective search space: 100624 Effective search space used: 100624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory