Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate GFF2744 PGA1_c27870 CoA-transferase, family III
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__Phaeo:GFF2744 Length = 375 Score = 401 bits (1030), Expect = e-116 Identities = 211/378 (55%), Positives = 257/378 (67%), Gaps = 13/378 (3%) Query: 1 MGALSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENT 60 M L+ L+V++L+R+LAGPW GQ LADLGA+VIKVE P GDDTR WGPPF+ + G+ T Sbjct: 1 MTPLAGLKVVELARILAGPWIGQSLADLGAEVIKVESP-EGDDTRRWGPPFI-ERDGDKT 58 Query: 61 TEAAYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKA 120 AAYY +ANR K VT DF +G++ V EL +DILIENFKVGGLA YGLDYDSLKA Sbjct: 59 --AAYYYAANRGKSCVTADFRTKDGKQTVLELIRDADILIENFKVGGLAKYGLDYDSLKA 116 Query: 121 INPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDI 180 +NP+LIYCS+TGFGQ GPYA RAGYDF++QG+ GLMS+TG PEG+ P KVGVA+TDI Sbjct: 117 VNPRLIYCSVTGFGQDGPYAARAGYDFLLQGMSGLMSITGAPEGE----PQKVGVAITDI 172 Query: 181 LTGLYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHP 240 +TGLY T ILAA+ R G GQHIDM+LLD A LANQ MNYL TG +P R+GN HP Sbjct: 173 VTGLYGTIGILAAVEQRHSTGRGQHIDMSLLDCATAVLANQNMNYLATGTSPTRMGNEHP 232 Query: 241 NIVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLI 300 NI PYQ DG IL VGNDGQF + V ADDPRFA+N++RVANR L P++ Sbjct: 233 NIAPYQVMAVRDGHVILAVGNDGQFARLCAVLNMAGLADDPRFASNQLRVANRVELTPML 292 Query: 301 RQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVAS 360 A A+ + LE A VP GPIN + Q F DPQ++ R + + VP V Sbjct: 293 AAALAQWGQADLLAALEAATVPAGPINTIGQAFDDPQIKHRQM-----QIAPEDVPGVRG 347 Query: 361 PIRLSETPVEYRNAPPLL 378 P S+ + + P+L Sbjct: 348 PWVFSDAELALEKSAPIL 365 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 531 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 375 Length adjustment: 31 Effective length of query: 375 Effective length of database: 344 Effective search space: 129000 Effective search space used: 129000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory