Align L-arabonate dehydratase (EC 4.2.1.25) (characterized)
to candidate GFF2902 PGA1_c29490 dihydroxy-acid dehydratase LivD
Query= reanno::pseudo5_N2C3_1:AO356_24585 (578 letters) >FitnessBrowser__Phaeo:GFF2902 Length = 614 Score = 230 bits (587), Expect = 1e-64 Identities = 175/560 (31%), Positives = 278/560 (49%), Gaps = 59/560 (10%) Query: 25 RSWMKNQGIADHQFHGKPIIGICNTWSELTPCNAHFRQIAEHVKRGVIEAGGFPVEFPVF 84 R + G+ D F GKPII I N++++ P + H + + + V R V AGG EF Sbjct: 19 RGLWRATGMTDDDF-GKPIIAIVNSFTQFVPGHVHLKDLGQMVAREVEAAGGVAKEFNTI 77 Query: 85 SNGES-NLRPTAML----TRNLASMDVEEAIRGNPIDGVVLLTGCDKTTPALLMGAASCD 139 + + + ML +R + + VE + + D +V ++ CDK TP +LM A + Sbjct: 78 AVDDGIAMGHDGMLYSLPSREVIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLN 137 Query: 140 VPAIVVTGGPMLNGKHKGQDIGSGTV-VWQLSEQVKAGTITIDDFLAAEGGMSRSAGTCN 198 +PAI V+GGPM GK D+ + + + T+T + E + G+C+ Sbjct: 138 IPAIFVSGGPMEAGKIDIADLDMKKIDLVDAMVAAASDTMTDEQVQHIEENACPTCGSCS 197 Query: 199 TMGTASTMACMAEALGTSLPHNAAIPAVDARRYVLAHMSGMRAVEMVR-------EDLKL 251 M TA++M C+AEALG +LP N + A A R L +G + V++ + + L Sbjct: 198 GMFTANSMNCLAEALGLALPGNGSTLATHADRKHLFLEAGRKIVDITKRHYVGEEKGLLP 257 Query: 252 SKILTKEAFENAIRVNAAIGGSTNAVIHLKAIAGRIGVQLDLDDWTRIGRGMPTIVDLQP 311 +I T +AFENA+ ++ A+GGSTN V+HL AIA V + D R+ R +P + + P Sbjct: 258 REIATFDAFENAMSLDIAMGGSTNTVLHLLAIANEGKVDFTMTDMDRLSRKVPCLCKVAP 317 Query: 312 S-GRFLMEEFYYAGGLPAVLRRLGEANLIPNPNALTVNGKSLGE----------NTKDA- 359 + ME+ + AGG+ ++L L A L+ N TV+ ++GE N DA Sbjct: 318 NIENVHMEDVHRAGGIFSILGELSRAGLLHN-ECSTVHSSTMGEAIAKWDIKVANNPDAE 376 Query: 360 -------------PIYGQDE------------VIRTLDNPIRADGGICVLRGNLAPLGAV 394 + Q VIR+ D+ DGG+ VL GN+A G + Sbjct: 377 ALFKAAPGGVRTTEAFSQSNRYKELDTDREGGVIRSKDHAFSQDGGLAVLFGNIARDGCI 436 Query: 395 LKPSAATAELMQHRGRAVVFENFDEYKARIND-PELDVDANSILVMKNCGPKGYPGMAEV 453 +K + +++ G A V E+ D+ +ND V ++V++ GP+G PGM E+ Sbjct: 437 VKTAGVDDNILKFTGSAYVCESQDQ---AVNDILTSKVKEGDVVVIRYEGPRGGPGMQEM 493 Query: 454 GNMGLPAKLLAQGV-TDMVRISDARMSGTAYGTVVLHVAPEAAAGGPLAAVKEGDWIELD 512 + + L ++G+ ++D R SG G + HV+PEAA GG + V++GD IE+D Sbjct: 494 --LYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHVSPEAAEGGTIGLVQQGDTIEID 551 Query: 513 CASGRLHLDIPDAELAARLA 532 + +HL + D ELAAR A Sbjct: 552 IPNRTIHLAVSDEELAARRA 571 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 802 Number of extensions: 42 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 578 Length of database: 614 Length adjustment: 37 Effective length of query: 541 Effective length of database: 577 Effective search space: 312157 Effective search space used: 312157 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory