Align D-xylose ABC transporter, permease protein (characterized)
to candidate GFF3640 PGA1_262p00440 xylose transport system permease protein XylH
Query= CharProtDB::CH_024441 (393 letters) >FitnessBrowser__Phaeo:GFF3640 Length = 433 Score = 229 bits (584), Expect = 1e-64 Identities = 139/406 (34%), Positives = 214/406 (52%), Gaps = 38/406 (9%) Query: 25 LNLQVFVMIAAIIAIMLFFTWTTDGAYLSARNVSNLLRQTAITGILAVGMVFVIISAEID 84 L++++ MI A + + + F TDG +L+ RN+ NL QT I+A GMVFVI++ ID Sbjct: 23 LDVRLLGMIGAFVILCIGFNILTDGRFLTPRNIFNLTIQTVSVAIMATGMVFVIVTRHID 82 Query: 85 LSVGSMMGLLGGVAAICDV-------WLGWPLPLTIIVTLVLGL----LLGAWNGWWVAY 133 LSVG+++ V A+ LG P T I+T+ +GL L+GA+ GW V + Sbjct: 83 LSVGALLATCSAVMAVVQTDVLPDMFGLGLNHPATWIITVAVGLAIGTLIGAFQGWMVGF 142 Query: 134 RKVPSFIVTLAGMLAFRGILIGITNGTTVSPTSAAMSQIG--QSYLPASTGFIIGALGLM 191 +P+FIVTL G L +R + +T+G T+ P + G L + +++G + + Sbjct: 143 LTIPAFIVTLGGFLVWRNVAWYLTDGQTIGPLDSTFLVFGGTSGTLGTTLSWVVGIVATL 202 Query: 192 AFVGWQWRGRMRRQALGLQSPASTAVVGRQALTAIIVLGAIWLLNDYR------------ 239 + W R +Q G + A A +LG + +LN Y+ Sbjct: 203 LALAALWNSRRAKQGHGFPVKPAWAEAVIAGSIAASILGFVAILNAYQIPARRLKRMMEA 262 Query: 240 -------------GVPTPVLLLTLLLLGGMFMATRTAFGRRIYAIGGNLEAARLSGINVE 286 G+P VL+L + +A RT GR I+A GGN +AA LSGIN Sbjct: 263 QGETMPEGLVVGYGLPISVLILIATAVVMTIIARRTRLGRYIFATGGNPDAAELSGINTR 322 Query: 287 RTKLAVFAINGLMVAIAGLILSSRLGAGSPSAGNIAELDAIAACVIGGTSLAGGVGSVAG 346 + +FA+ G + A++ ++ S+RL S G + EL IAA VIGGT+L+GG G++ G Sbjct: 323 LLTVKIFALMGFLCALSAVVASARLANHSNDIGTLDELRVIAAAVIGGTALSGGFGTIYG 382 Query: 347 AVMGAFIMASLDNGMSMMDVPTFWQYIVKGAILLLAVWMDSATKRR 392 A++GA IM SL +GM+M+ V +Q IV G +L+ AVW+D ++R Sbjct: 383 AILGALIMQSLQSGMAMVGVDAPFQNIVVGTVLVAAVWIDILYRKR 428 Lambda K H 0.325 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 433 Length adjustment: 31 Effective length of query: 362 Effective length of database: 402 Effective search space: 145524 Effective search space used: 145524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory