Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate GFF3834 PGA1_262p02380 putative histidine transport system permease protein HisM
Query= TCDB::Q9HU29 (230 letters) >FitnessBrowser__Phaeo:GFF3834 Length = 258 Score = 152 bits (383), Expect = 8e-42 Identities = 88/223 (39%), Positives = 127/223 (56%), Gaps = 10/223 (4%) Query: 4 WELILKWMPKMLQGAALTLELLAIAVVAGLALALPLGIARASRHWYVRAVPYAYIFFFRG 63 W+ I + P L+G T+ +L + + G ALA+PLG+A+A WY+ + RG Sbjct: 32 WDWIPTYAPLALEGLWTTIWILVVTSILGFALAVPLGLAQAVGPWYLSTPARIFCTVIRG 91 Query: 64 TPLLLQLFIVYYGLA----QFEEVRKSAFWPYLRDPYWCALLTMTLHTAAYIAEILRGAI 119 TPLLLQ++++YYGL QF +R S WPYLR + A+L +TL A Y E++RGA Sbjct: 92 TPLLLQIWLLYYGLGSLFPQFPWIRSSELWPYLRQAWPYAVLALTLSYAGYEGEVMRGAF 151 Query: 120 HSVPVGEVEAARALGMSRRQALWHIILPRAVRIGLPAYSNEVILMLKASAVVYTVTLFDI 179 V G++EAA+A GM R I LP+AVR LP E IL LKA+ +V T+T+ DI Sbjct: 152 SGVAKGQLEAAKAYGMPRLTMFRRIWLPQAVRNVLPTLGGETILQLKATPLVATITVLDI 211 Query: 180 MGMARTIIART---YESMLFFCLAGALYLVITIVLTRIFRLIE 219 ++ + + T YE +L L +Y+ I V+T F+ E Sbjct: 212 YAVSSRVRSDTFIVYEPLLLLAL---VYMAIAGVITLAFKRFE 251 Lambda K H 0.332 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 230 Length of database: 258 Length adjustment: 24 Effective length of query: 206 Effective length of database: 234 Effective search space: 48204 Effective search space used: 48204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory