Align Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate GFF385 PGA1_c03960 ribose import ATP-binding protein RbsA
Query= TCDB::G4FGN3 (494 letters) >FitnessBrowser__Phaeo:GFF385 Length = 509 Score = 312 bits (800), Expect = 2e-89 Identities = 182/503 (36%), Positives = 293/503 (58%), Gaps = 14/503 (2%) Query: 3 PILEVKSIHKRFPGVHALKGVSMEFYPGEVHAIVGENGAGKSTLMKIIAGVYQPDEGEII 62 P +E+K I K F V A K +S+ PG +H I+GENGAGKSTLM I+ G Y+ D+GE+ Sbjct: 4 PAIELKGISKAFGPVQANKDISIRVAPGTIHGIIGENGAGKSTLMSILYGFYKADKGEVW 63 Query: 63 YEGRGVRWNHPSEAINAGIVTVFQELSVMDNLSVAENIFMGDEEKRGIFIDYKKMYREAE 122 G+ AI+AGI VFQ +++N +V ENI +G E+ G+ R++ Sbjct: 64 IHGKRTEIPDSQAAISAGIGMVFQHFKLVENFTVLENIILGAEDG-GLLKPSLSKARKSL 122 Query: 123 KFMKEEFGIEIDPEEKLGKYSIAIQQMVEIARAVYKKAKVLILDEPTSSLTQKETEKLFE 182 K + E+ + +DP+ ++ + + +QQ VEI +A+Y++A +LILDEPT LT E ++LF Sbjct: 123 KDLAAEYELNVDPDARIDEIGVGMQQRVEILKALYRQADILILDEPTGVLTPAEADQLFR 182 Query: 183 VVKSLKEKGVAIIFISHRLEEIFEICDKVSVLRDGEYIGTDSIENLTKEKIVEMMVGRKL 242 ++ L+ +G II I+H+L EI E D VSV+R GE T + E + E+MVGRK+ Sbjct: 183 ILDRLRAEGKTIILITHKLREIMEYTDTVSVMRRGEMTATVKTAETSPEHLAELMVGRKV 242 Query: 243 EKFYIKEAHEPGEVVLEVKNLS------GERFENVSFSLRRGEILGFAGLVGAGRTELME 296 K PG+ +LE++NLS R +N+ ++R GEILG AG+ G G++ELME Sbjct: 243 LLRVDKVPATPGKPILEIENLSVVDEAGVARVKNIDLTVRAGEILGIAGVAGNGQSELME 302 Query: 297 TIFGFRPKRGGEIYIEGKRVEINHP-LDAIEQ---GIGLVPEDRKKLGLILIMSIMHNVS 352 + G R + G I + G + ++ DA + + VPEDR++ GLI+ NV+ Sbjct: 303 VLGGMREGQ-GSIRLNGAPLPLSGAGSDARARRAAHVAHVPEDRQREGLIMDFHAWENVA 361 Query: 353 L--PSLDRIKKGPFISFKREKELADWAIKTFDIRPAYPDRKVLYLSGGNQQKVVLAKWLA 410 ++G ++ + + + FD+RP P SGGNQQK+V+A+ + Sbjct: 362 FGYHHAPEYQRGLLMNNAALRADTEAKMAKFDVRPPDPWLAAKNFSGGNQQKIVVAREIE 421 Query: 411 LKPKILILDEPTRGIDVGAKAEIYRIMSQLAKEGVGVIMISSELPEVLQMSDRIAVMSFG 470 P++L++ +PTRG+D+GA I++ + +L +G ++++S EL E+L ++DR+AVM G Sbjct: 422 RNPELLLIGQPTRGVDIGAIEFIHKQIVELRDQGKAILLVSVELEEILSLADRVAVMFDG 481 Query: 471 KLAGIIDAKEASQEKVMKLAAGL 493 + G A + ++++ L AG+ Sbjct: 482 MIMGERPADQTDEKELGLLMAGV 504 Lambda K H 0.318 0.138 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 667 Number of extensions: 39 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 509 Length adjustment: 34 Effective length of query: 460 Effective length of database: 475 Effective search space: 218500 Effective search space used: 218500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory