Align Glycine cleavage system H protein; Octanoyl/lipoyl carrier protein (characterized)
to candidate GFF3866 PGA1_78p00300 glycine cleavage system protein GcvH
Query= SwissProt::P64213 (126 letters) >FitnessBrowser__Phaeo:GFF3866 Length = 121 Score = 126 bits (317), Expect = 9e-35 Identities = 54/117 (46%), Positives = 84/117 (71%) Query: 9 YSKEHEWVKVEGNVATIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVESVKTVSEL 68 YS++HEW+ VEG+ AT+GIT++A +LG++VFVE ++ +E +G G +ESVK SE+ Sbjct: 5 YSEDHEWITVEGDTATLGITKHAADQLGEVVFVEQQDSGEEFEKGGEIGVIESVKAASEI 64 Query: 69 YAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQLEALLTAEKYSEMIG 125 YAP+ G++ VNE+L D+P +NE P AW+ K+++SD +QLE L+ + Y +IG Sbjct: 65 YAPLDGEITAVNEDLADNPSALNEDPEGAAWIYKIKLSDSAQLEDLMDLDGYKALIG 121 Lambda K H 0.305 0.127 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 71 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 126 Length of database: 121 Length adjustment: 14 Effective length of query: 112 Effective length of database: 107 Effective search space: 11984 Effective search space used: 11984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.0 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory