Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate GFF3909 PGA1_65p00120 putative amino-acid ABC transporter, permease protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3432 (229 letters) >FitnessBrowser__Phaeo:GFF3909 Length = 224 Score = 100 bits (248), Expect = 3e-26 Identities = 71/222 (31%), Positives = 119/222 (53%), Gaps = 13/222 (5%) Query: 4 GYGAVILDGVWLTLQLALSSMVLAIVLGLIGVALRLSPIRWLAWLGDLYSTVIRGIPDLV 63 G V+L V LTL +A+ +MVLA+VL + R+ I L L L+ + RG P LV Sbjct: 11 GLVPVLLSYVPLTLFMAVVAMVLALVLASLLAVERVLRIPVLDQLVVLFISFFRGTPLLV 70 Query: 64 LILLIFYGGQDLLNRVAPMFGYDDYIDLNPLAAGIGTLGFIFGAYLSETFRGAFMAIPKG 123 + L +YG +L+ + +N ++A I L F AY++E+ R A + + + Sbjct: 71 QLFLFYYGLPQVLSVLT---------QINGVSAAIMGLTLHFAAYMAESIRAAILGVDRS 121 Query: 124 QAEAGMAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQ 183 Q EA + GM+ Q+ R+++PQ R+A P N ++ + K T+L +G+ +MM ++ Sbjct: 122 QWEAAQSIGMTRGQMMRRIVLPQAARIAAPTLVNYFIDMIKGTSLAFTLGVTEMMGATQK 181 Query: 184 AADATREPFTFFLAVAAMY-LVITSVSLLALR---HLEKRYS 221 A + F FL VA +Y +++ ++SL+ R HL K Y+ Sbjct: 182 EAAGSFLYFEAFLVVAVIYWILVEALSLVQRRLETHLNKAYA 223 Lambda K H 0.329 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 224 Length adjustment: 22 Effective length of query: 207 Effective length of database: 202 Effective search space: 41814 Effective search space used: 41814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory