Align gluconate/galactonate dehydratase (EC 4.2.1.140); gluconate dehydratase (EC 4.2.1.39) (characterized)
to candidate GFF443 PGA1_c04540 putative d-galactonate dehydratase
Query= BRENDA::Q6L1T2 (391 letters) >FitnessBrowser__Phaeo:GFF443 Length = 410 Score = 185 bits (470), Expect = 2e-51 Identities = 130/365 (35%), Positives = 181/365 (49%), Gaps = 19/365 (5%) Query: 14 SPGEKSSPWSSTILIVKLTSSNGNIGYGEAPTTFMTLP-VKESMREV-ERVFKDQNYFNI 71 +PG W ++VK+T+ G G+GE + + +R+V ER + N NI Sbjct: 15 APGWGGRYW----ILVKVTTDTGITGWGECYAASVGPDAMTHVIRDVFERHMQGMNPENI 70 Query: 72 EKNMREFYKHSFYLSRSMEATSALSAFEIASWDLIGKDLGTPVYNLLGGEYNSELRAYAN 131 E R Y F + A S EIA WD++GKD PV+ L+GG N LRAY Sbjct: 71 EWMFRRAYSSGFTQRPDLSVMGAFSGLEIACWDILGKDRDRPVHALIGGRMNDRLRAYTY 130 Query: 132 GWYSDCLEPDDF-------VSRAKEYIKKGYTAFKFDPFRNNFDRIGN----DGIKKAVD 180 + + D F A ++KGYTA KFDP R G+ I ++V Sbjct: 131 LYPLPHHDIDAFWNTPELAAESAIAAVEKGYTAVKFDPAGPYTMRGGHMPAQSDITQSVA 190 Query: 181 IVSAMRSELGENIDLLIECHGRFSTKYAIKVGQALDEFNPLFIEEPIHPEMELGLFDFKR 240 A+R +G+ DLL HG+F+ AI++GQAL+ + PL+ EEP P++ + Sbjct: 191 FCRAIREAVGDRADLLFGTHGQFTPAGAIRLGQALESYEPLWFEEPTPPDLVADMARVAD 250 Query: 241 YVNTPVALGERLLNKEDFARYISQGMVDIVQADLTNSKGILEAKKISAIVESFGGLMAFH 300 V PVA GERL K +FA + G +I+Q L S GI E KKI+AI E FG MA H Sbjct: 251 RVRIPVATGERLTTKAEFAAILRAGAAEILQPALGRSGGIWETKKIAAIAEVFGAQMAPH 310 Query: 301 NAFGPVQTAATLNVDYTLTNFLIQESFEDSWPDWKRNLFSGYRIENGHFKLSGKPGLGIT 360 GPV+ AA + + ++ N L+ E+ E P + G +E+G S PGLGI Sbjct: 311 LYAGPVEWAANIQLAASIPNLLMIETIET--PFHTALIKQGITVEDGFVIPSDTPGLGIE 368 Query: 361 ADEKL 365 DE L Sbjct: 369 VDEDL 373 Lambda K H 0.317 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 410 Length adjustment: 31 Effective length of query: 360 Effective length of database: 379 Effective search space: 136440 Effective search space used: 136440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory