Align tartronate semialdehyde reductase 2 (characterized)
to candidate H281DRAFT_00785 H281DRAFT_00785 2-hydroxy-3-oxopropionate reductase
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__Burk376:H281DRAFT_00785 Length = 302 Score = 377 bits (968), Expect = e-109 Identities = 193/292 (66%), Positives = 233/292 (79%), Gaps = 3/292 (1%) Query: 2 KLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADEL-LSLGAVSVETARQVTEASDIIF 60 K+GFIGLGIMG MA NL + GH L V PV ++L S VS TA V +A+DI+ Sbjct: 3 KIGFIGLGIMGAHMARNLLKGGHTLFVNGAYPVPEDLGKSTNVVSDSTA--VAQAADIVI 60 Query: 61 IMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVS 120 IMVPDTP V VLF ++G GK ++DMSSISP++T+ FA+++N LG DYLDAPVS Sbjct: 61 IMVPDTPDVANVLFADDGVAAGLTAGKLVIDMSSISPLDTQAFAKKINALGVDYLDAPVS 120 Query: 121 GGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNI 180 GGE+GARE TL+IMVGG E F + KPLFEL+GKNI+L+G NG GQTCKVANQIIVALNI Sbjct: 121 GGEVGAREATLTIMVGGPEKAFAQAKPLFELMGKNISLIGDNGAGQTCKVANQIIVALNI 180 Query: 181 EAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLN 240 EAV+EALLFAS++GADP RVR+ALMGGFASSRILEVHGERM KRTFNPGF+I LHQKDLN Sbjct: 181 EAVAEALLFASRSGADPERVRKALMGGFASSRILEVHGERMTKRTFNPGFRIELHQKDLN 240 Query: 241 LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKLA 292 LAL A+ L + LP+TA+ Q+LF+ CAANGG DHSA+V+ALE+MAN+++A Sbjct: 241 LALDGARKLGIALPHTASAQQLFSVCAANGGKAWDHSAMVRALEIMANYEVA 292 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 302 Length adjustment: 26 Effective length of query: 266 Effective length of database: 276 Effective search space: 73416 Effective search space used: 73416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate H281DRAFT_00785 H281DRAFT_00785 (2-hydroxy-3-oxopropionate reductase)
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.28240.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-123 395.9 5.7 5.6e-123 395.8 5.7 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_00785 H281DRAFT_00785 2-hydroxy-3-oxop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_00785 H281DRAFT_00785 2-hydroxy-3-oxopropionate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 395.8 5.7 5.6e-123 5.6e-123 1 291 [] 3 291 .. 3 291 .. 0.97 Alignments for each domain: == domain 1 score: 395.8 bits; conditional E-value: 5.6e-123 TIGR01505 1 kvgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtmvPds 66 k+gfiGlGimG m++nllk G+ l v ++ ++ l +++++ +v+++ad++++mvPd+ lcl|FitnessBrowser__Burk376:H281DRAFT_00785 3 KIGFIGLGIMGAHMARNLLKGGHTLFVNGAY-PVPED-LGKSTNVVSDSTAVAQAADIVIIMVPDT 66 89************************99887.56555.5667788888899*************** PP TIGR01505 67 PqveevalGenGileaakkGkvlvdmssiaPleskelakavkekGidvldaPvsGGeagaiegtls 132 P+v +v++ ++G+ + Gk+++dmssi+Pl+++ +ak+++++G+d+ldaPvsGGe+ga+e+tl+ lcl|FitnessBrowser__Burk376:H281DRAFT_00785 67 PDVANVLFADDGVAAGLTAGKLVIDMSSISPLDTQAFAKKINALGVDYLDAPVSGGEVGAREATLT 132 ****************************************************************** PP TIGR01505 133 imvGGdkavfdkvkpllealgksivlvGenGaGqtvkvanqvivalnieavsealvlaekaGvdpk 198 imvGG + f ++kpl+e++gk+i l+G+nGaGqt+kvanq+ivalnieav+eal++a+++G+dp+ lcl|FitnessBrowser__Burk376:H281DRAFT_00785 133 IMVGGPEKAFAQAKPLFELMGKNISLIGDNGAGQTCKVANQIIVALNIEAVAEALLFASRSGADPE 198 ****************************************************************** PP TIGR01505 199 avlqalrGGlagstvleakkerlldrdfkPGfridlhqkdlalaldaakavgaalPvtavvaella 264 +v++al+GG+a+s++le+++er+ +r+f+PGfri+lhqkdl+lald a+ +g+alP ta+ ++l++ lcl|FitnessBrowser__Burk376:H281DRAFT_00785 199 RVRKALMGGFASSRILEVHGERMTKRTFNPGFRIELHQKDLNLALDGARKLGIALPHTASAQQLFS 264 ****************************************************************** PP TIGR01505 265 alradGdgtldhsalvraleklakdkv 291 ++a+G+ dhsa+vrale +a+ +v lcl|FitnessBrowser__Burk376:H281DRAFT_00785 265 VCAANGGKAWDHSAMVRALEIMANYEV 291 ***********************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 11.27 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory