Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate H281DRAFT_05872 H281DRAFT_05872 amino acid ABC transporter membrane protein 2, PAAT family
Query= TCDB::A1VZQ3 (250 letters) >FitnessBrowser__Burk376:H281DRAFT_05872 Length = 214 Score = 150 bits (378), Expect = 3e-41 Identities = 70/209 (33%), Positives = 127/209 (60%), Gaps = 1/209 (0%) Query: 35 LDALDNK-DAFINGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQN 93 L+ L N + G + TL +SI A++ +T+ G + V+ + ++Y ELF+ Sbjct: 3 LELLKNSLSILLQGLVTTLLLSIAAIVGSTLIGLLAAVLRSFGPWGTDRIAKLYTELFRG 62 Query: 94 VPLVIQIFFLFYALPVLGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPRGQFEASAS 153 P++I + F+++ + G +D+F GV+G+ Y GAY++EV R+GI +VP+GQ+E S Sbjct: 63 TPVLITLMFIYFGVSYFGYAIDVFAAGVIGLSVYQGAYIAEVFRAGIESVPKGQWEVSQI 122 Query: 154 QGFTYIQQMRYIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAADYGN 213 G + IQ +++PQT RI+LPP+ Q ++LIK+TS++ ++G +ELMH + G Sbjct: 123 LGLSRIQTFASVVLPQTGRIVLPPLVGQYLSLIKDTSIVSMIGMSELMHGGQAIVDRVGK 182 Query: 214 YAPAYIFAAVLYFIICYPLAYFAKAYENK 242 Y A++YF++C+PL+ + + ++ + Sbjct: 183 PVEIYGLVALIYFVVCFPLSQWVRHHDRR 211 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 214 Length adjustment: 23 Effective length of query: 227 Effective length of database: 191 Effective search space: 43357 Effective search space used: 43357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory