Align IGP synthase glutamine amidotransferase subunit; EC 2.4.2.- (characterized)
to candidate HSERO_RS21015 HSERO_RS21015 imidazole glycerol phosphate synthase
Query= CharProtDB::CH_024511 (196 letters) >FitnessBrowser__HerbieS:HSERO_RS21015 Length = 202 Score = 135 bits (339), Expect = 6e-37 Identities = 84/203 (41%), Positives = 117/203 (57%), Gaps = 11/203 (5%) Query: 3 VVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRE--- 59 + I++ G NL S+ + R G + ++ DP+ V A+KL LPGVG AAM ++ E Sbjct: 2 ITIVNYGMGNLGSLLNMFKRIGVKARIESDPEAVRDAEKLVLPGVGAFDAAMHRINETPG 61 Query: 60 -RELFDLIKACTQ--PVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDF-GLPLPH 115 R D KA + PV+G+CLGMQLL R SEE + LG ID + + GL +PH Sbjct: 62 LRAALDH-KALIERVPVIGVCLGMQLLTRSSEEGK-LPGLGWIDGEAIRFPRIDGLKVPH 119 Query: 116 MGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPV-NP-WTIAQCNYGEPFTAAVQKDNFY 173 MGWN +P + L I +YFVHSY + V NP ++ + YG F +A+ +DN Y Sbjct: 120 MGWNVAHPATPSALTNDIGIEPRYYFVHSYFVKVDNPVHSLMRTQYGVEFDSAIGRDNIY 179 Query: 174 GVQFHPERSGAAGAKLLKNFLEM 196 G QFHPE+S G K+L+NF E+ Sbjct: 180 GAQFHPEKSHRFGMKILQNFAEL 202 Lambda K H 0.322 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 202 Length adjustment: 21 Effective length of query: 175 Effective length of database: 181 Effective search space: 31675 Effective search space used: 31675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate HSERO_RS21015 HSERO_RS21015 (imidazole glycerol phosphate synthase)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.17234.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.17234.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.