Align 2-aminomuconate 6-semialdehyde dehydrogenase (EC 1.2.1.32) (characterized)
to candidate N515DRAFT_0379 N515DRAFT_0379 Acyl-CoA reductase
Query= metacyc::MONOMER-13361 (500 letters) >FitnessBrowser__Dyella79:N515DRAFT_0379 Length = 476 Score = 214 bits (544), Expect = 7e-60 Identities = 146/475 (30%), Positives = 238/475 (50%), Gaps = 19/475 (4%) Query: 23 YIDGNFVTSASSFANINPVNGKLISDVFEADAKQVNEAVVAAQNALKGPWGKLSVQDRAA 82 Y+ TS + ++ +GK+ + V DAK +A+ AA A + P + +R A Sbjct: 9 YLANKAQTSKAWMDVLDKYSGKVATRVAVPDAKATEQAIAAAVKAAE-PMRQFKPWERQA 67 Query: 83 LIHKIADGIQARFEEFVAAEVADTGRPVHQARTLDIPRAIANFRTFADLAKTSHTDLFEM 142 ++ R +E A + G+P+ + ++ R I F A+ A ++ + + Sbjct: 68 VLQHCVQRFTERRDELAYALCVEAGKPIKDSAG-EVTRLIETFGIAAEEAVRTNGETINL 126 Query: 143 STSDG-SGALNYTVRKPLGVIGVISPWNLPLLLFTWKVAPALACGNTVVAKPSEESPSSA 201 + +G YT R PLG + I+P+N PL L KVAPA+A G V KP+E +P A Sbjct: 127 EIAKRLNGYHGYTRRVPLGPVSFITPFNFPLNLVAHKVAPAIAAGCPFVLKPAERTPIGA 186 Query: 202 TLLAEVMHDAGVPPGVFNLIHGFGKDSAGEFLTQHPGISALTFTGESKTGSTIMKAVADG 261 ++ EV+ + +P G F++++ GK ++ L + P L+FTG +A G Sbjct: 187 LIIGEVLAETDLPKGAFSILNLDGKHASP--LVEDPRFKLLSFTGSQIGWDLKTRA---G 241 Query: 262 VKEVSFELGGKNAAVVFAD--ADLDAAIEGVLRSSFTNSGQVCLCSERVYVHRSIFDEFV 319 K+V+ ELGG A +V AD LD IE ++ +F SGQ C+ +R+Y H S++DE Sbjct: 242 HKKVTLELGGNAACIVDADQLPRLDHVIERLVFGAFYQSGQSCISVQRIYAHESLYDELK 301 Query: 320 SGLKVEAERLVVGYPDQDGVNMGPLISHGHRDKVLSYYRLAVDEGATVVTGGGVPKFNDE 379 L + L G P + +GP+I +++ + A G V+ GG Sbjct: 302 KRLVAAVKGLKAGDPKKKETFLGPMIDEAAAERLHGWIEEARKGGGKVLCGG-------- 353 Query: 380 RDQGAYVQPTIWTGLSDKARCVTEEIFGPVCHISPFDDEDEVINRVNDSNYGLACAIWTT 439 + +G ++ T+ + A+ +E+FGP ++PF DE I NDS+YGL I+T Sbjct: 354 KRKGPMLEATLMENVRGDAKVNRQEVFGPFALLAPFKSLDEAIAMTNDSDYGLQAGIFTD 413 Query: 440 NLSRAHRVSRQIHVGLVWVN-TWYLRDLRTPFGGVKLSGLGREGGRFSMDFYSDI 493 +L+ A R ++ G V VN R P+GGVKLSG GREG R++++ ++I Sbjct: 414 SLANAMRAWNELEQGGVIVNDVPSFRVDNMPYGGVKLSGAGREGVRYAIEDMTEI 468 Lambda K H 0.318 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 476 Length adjustment: 34 Effective length of query: 466 Effective length of database: 442 Effective search space: 205972 Effective search space used: 205972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory