Align Purine nucleoside phosphorylase; PNP; EC 2.4.2.1 (uncharacterized)
to candidate N515DRAFT_0396 N515DRAFT_0396 5'-methylthioadenosine phosphorylase
Query= curated2:Q9KYV7 (280 letters) >FitnessBrowser__Dyella79:N515DRAFT_0396 Length = 247 Score = 199 bits (505), Expect = 6e-56 Identities = 112/250 (44%), Positives = 148/250 (59%), Gaps = 11/250 (4%) Query: 8 EIGVIGGSGFYSF--LDDVTEVRVDTPYGPPSDSLFLGEVAGRRVAFLPRHGRGHHLPPH 65 ++ VIGGSG YSF L++ T VDTP+G S + +G+ AG+RVAFL RHG H +PPH Sbjct: 4 DLAVIGGSGLYSFPGLENTTRHGVDTPFGKTSADVVIGDFAGKRVAFLARHGESHGVPPH 63 Query: 66 RINYRANLWALRSVGARQVLGPCAVGGLRPEYGPGTLLVPDQFVDRTRSRPSTYFDGLPM 125 R+NYRANLWAL S+GAR V+G AVGG+R + GP ++VPDQ +D T R +++ D Sbjct: 64 RVNYRANLWALHSLGARTVIGVNAVGGIRDDMGPRAIVVPDQVIDYTHGRYTSFCDA--- 120 Query: 126 PDGTVPNVVHVSLADPYCPTGRAAALKAARGREWEPVDGGTLVVVEGPRFGTRAESLWHR 185 +G V H+ ++PY R + AA +DGG +GPR TRAE + Sbjct: 121 -EGA--EVKHIDFSEPYTAALRRQLVDAAGQAGIAVIDGGCYGATQGPRLETRAEIARMK 177 Query: 186 AQGWSVVGMTGHPEAALARELELCYTSLTLVTDLDAGAESGEGVSHEEV---LRVFAANV 242 G +VGMTG PEAALARELEL Y L LV + AG +S +E+ L+ A V Sbjct: 178 RDGCDLVGMTGMPEAALARELELAYACLALVANFAAGCGDEAEISIDEIFAHLKAATAEV 237 Query: 243 DRLRGVLFDA 252 R+ L A Sbjct: 238 PRILEALLKA 247 Lambda K H 0.320 0.140 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 247 Length adjustment: 25 Effective length of query: 255 Effective length of database: 222 Effective search space: 56610 Effective search space used: 56610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory