Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate N515DRAFT_0465 N515DRAFT_0465 aldehyde dehydrogenase (NAD+)
Query= BRENDA::P42412 (487 letters) >FitnessBrowser__Dyella79:N515DRAFT_0465 Length = 511 Score = 197 bits (500), Expect = 9e-55 Identities = 146/477 (30%), Positives = 218/477 (45%), Gaps = 10/477 (2%) Query: 13 GEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARIL 72 GEW + VNPAT EV+ V S+ D + + A EAFKTW PRR + Sbjct: 23 GEWSRTSDAGALQPVNPATGEVIGTVHASSAADYETIVKRAQEAFKTWRTTPAPRRGEAV 82 Query: 73 FNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLASIAT 132 + L +HK+ L L+ +E GK E GEV I+ +FA G ++ G ++ S Sbjct: 83 RLCGEALRKHKDALGSLVALEMGKIKPEGDGEVQEMIDIADFAVGQSRMLYGYTMHSERP 142 Query: 133 DVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPL---LTEKLV 189 +P+G+VG I+ FNFP+ V W +A G+ I KPS +TPL T K+ Sbjct: 143 GHRMYEQYHPLGLVGIISAFNFPVAVWAWNAFLAAICGDICIWKPSPKTPLSAIATMKIC 202 Query: 190 -ELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYVYKKGSENLKRVQ 248 E + G P F D+ G ++ I ISF GS VG V ++ + + R Sbjct: 203 NEALKAGGFPDIFFLFNDAGTDLSQGFVDDKRIPLISFTGSTKVGRMVGERVARRMGRSL 262 Query: 249 SLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKL--QE 306 G N I+ A+L+ + IV A G+AG+RC + V E I E KL Sbjct: 263 LELGGNNAIILDASADLKLAIPAIVFGAVGTAGQRCTTTRRLFVHESIVGEVTDKLVAAY 322 Query: 307 KVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVSDDGYFVGP 366 K + KIG+ +GP+ +D + L +EK G +++ G G FV P Sbjct: 323 KQVEGKIGDPTLATTLMGPLNSQDAVQAYLGAVEKAKASGGKVLTGGAALSDRKGNFVLP 382 Query: 367 TIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYFR 426 TI V + + E FAP+L ++ K+L EAIE+ N + +FT + A + Sbjct: 383 TIVTGVKNSDEVVQTETFAPILYIMPFKSLDEAIELQNDVPQGLSSAIFTRDLKAAEQYL 442 Query: 427 ENI--DAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRKKVVTARY 481 + D G+ +N+G F G K + G +G D+ Y R++ T+ Y Sbjct: 443 SSAGSDCGIANVNIGTSGAEIGGAFGGEKET--GGGRESGSDAWKVYMRRQTNTSNY 497 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 511 Length adjustment: 34 Effective length of query: 453 Effective length of database: 477 Effective search space: 216081 Effective search space used: 216081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory