Align N-acetylglucosamine porter, NagP (characterized)
to candidate N515DRAFT_0592 N515DRAFT_0592 glucose/galactose transporter
Query= TCDB::Q8EBL0 (435 letters) >FitnessBrowser__Dyella79:N515DRAFT_0592 Length = 430 Score = 306 bits (785), Expect = 6e-88 Identities = 182/439 (41%), Positives = 261/439 (59%), Gaps = 36/439 (8%) Query: 4 DKSQQKSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTF 63 D + S +PM I+ LFFI GF TWLNG L+ ++K L+ A L+ FY + F Sbjct: 10 DTHDRASGLVPMLIIGLLFFIFGFVTWLNGPLITFVKLAFSLDDVNAFLVPMVFYCSYFF 69 Query: 64 TALPSAWVIRKVGYKNGMALGMGVMMIAGLLFIPAAKTQVFALFLFAQLVMGAGQTLLQT 123 ALPS+ V+++ G K GMALG+ VM I +LF +V+ L V+GAG LLQT Sbjct: 70 LALPSSAVLKRTGMKKGMALGLFVMAIGAVLFGQFVSMRVYGGALAGLFVIGAGLALLQT 129 Query: 124 AVNPYVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALIL---DSFKDRIGTTLT--- 177 A NPY+ LGP +SAA R++ MGI NK AG +AP VF L+L D+F ++ T Sbjct: 130 ASNPYISILGPIDSAAQRIAFMGICNKVAGALAPFVFGWLVLSGIDTFDQQVKAAPTPEA 189 Query: 178 -QVQIDEMANGLVLPYLGMAVFIGILALAVKKSPLPEL----SNEDEVADHTDKSQIKAA 232 + ++ A + +PYL MA + +LA+ V +SPLPE+ +N + H + Sbjct: 190 REALLNTFAAKVHMPYLAMAGLLVLLAVWVLRSPLPEIKPSGANSEAEIGHAKGN----L 245 Query: 233 LSHPNLALGVLALFVYVAVEVIAGDTIGTFALSLG--IDHYGVMTSYTMVCMVLGYILGI 290 LS P+L LGVL LF+YV VEV+AGD IGT+ LG +D TS+T+ M+LGY+ G+ Sbjct: 246 LSFPHLWLGVLCLFLYVGVEVMAGDAIGTYGQGLGLPLDATKHFTSFTLFAMLLGYLAGL 305 Query: 291 LLIPRVISQPTALMISAILGLLLTLGILFGDNNSYAIANLLLVPFGGVALPDTLLLIAFL 350 +LIP++ISQ + L +SA+LG+ T+G ++A V F +A L Sbjct: 306 VLIPKIISQQSYLAVSAVLGVAFTVG-------AWATTGYTSVGF-----------VAAL 347 Query: 351 GLANAIVWPAVWPLALSGMGKLTSTGSALLIMGIAGGAFGPVSWGLMSSATDMGQQGGYM 410 G ANA++WPA++PLA+ G+G+ T GSALLIM I GGA P ++ + D Q + Sbjct: 348 GFANAMMWPAIFPLAIKGLGRWTEAGSALLIMAIVGGALVPQAFVHLKQHYDF-QLVFML 406 Query: 411 VMLPCYLFILFYAVKGHKM 429 +M+PCYL+ILFY ++GH++ Sbjct: 407 LMVPCYLYILFYGLRGHRV 425 Lambda K H 0.326 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 656 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 435 Length of database: 430 Length adjustment: 32 Effective length of query: 403 Effective length of database: 398 Effective search space: 160394 Effective search space used: 160394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory