Align 1-phosphofructokinase (EC 2.7.1.56) (characterized)
to candidate N515DRAFT_0917 N515DRAFT_0917 tagatose 6-phosphate kinase
Query= reanno::pseudo5_N2C3_1:AO356_07330 (313 letters) >FitnessBrowser__Dyella79:N515DRAFT_0917 Length = 310 Score = 163 bits (412), Expect = 6e-45 Identities = 101/273 (36%), Positives = 143/273 (52%) Query: 10 NPALDLTVELARLEPGQVNRSDAMHAHAAGKGVNVAQVLADLGHTLTVSGFLGEDNAQVF 69 N A+D L LEPG V R+ + A+ GKG++VAQ +A LG + + G + + Sbjct: 8 NTAIDRLYTLDALEPGAVQRAANVQAYPGGKGLHVAQTIAALGEPVQLVGLTDVFHRNLI 67 Query: 70 ETLFAQRGFVDAFIRVPGETRSNIKLAEQDGRITDLNGPGPMVDAAAQQALLARLEQIAP 129 ++RG + + + GE R + L E+DGR+T++ PGP++ AQQ LL L + Sbjct: 68 ARRMSERGVLFHGVEIAGELRHCLALRERDGRMTEVLDPGPLLPPRAQQQLLDTLWRCVE 127 Query: 130 GHDVVVVAGSLPRGVSPQWLQALIARMKALGLNVALDTSGEALRVALAAGPWLIKPNTEE 189 D +V++GSLPRG AL+ ++ GL +D SGEALR+A AG +L+KPN +E Sbjct: 128 DTDAMVLSGSLPRGFEADTYAALLRQIAPRGLPCLVDASGEALRLAADAGAFLLKPNRDE 187 Query: 190 LADALGCEVVSETAQAQAAQRLHAQGIEHVVISHGADGVNWFSVGAALHASPPKVSVAST 249 A G V + A A+ LHA+G+ VI+ GA G F HAS A+ Sbjct: 188 AAQLAGRAVDTVEDAAVVARALHARGVAFPVITLGARGALGFDGADCWHASLAIAHSANA 247 Query: 250 VGAGDSLLAGMLHGLLSADTPEQTLRTATAIAA 282 VG+GD LAG L P Q LR A A Sbjct: 248 VGSGDCFLAGAAVALRRGGEPAQALRLGVACGA 280 Lambda K H 0.317 0.132 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 310 Length adjustment: 27 Effective length of query: 286 Effective length of database: 283 Effective search space: 80938 Effective search space used: 80938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory