Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate N515DRAFT_1006 N515DRAFT_1006 3-oxoacyl-[acyl-carrier protein] reductase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__Dyella79:N515DRAFT_1006 Length = 248 Score = 89.4 bits (220), Expect = 7e-23 Identities = 74/251 (29%), Positives = 118/251 (47%), Gaps = 16/251 (6%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALA-----VFRDKYPGTVATRADV 66 G L++G + GIG +A A GA V V S A A VA + DV Sbjct: 6 GKVALVTGASKGIGAGIAKALAAEGAAVVVNYASSKAGADAVVDAITKAGGKAVAVKGDV 65 Query: 67 SDAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAH 126 + AA +A+ + G LD+LVNN+G+ ++ I++ + N+N+ Sbjct: 66 AQAADAQAIADAAVKEFGRLDILVNNSGVY-EFAPLEQITEDHFHKQFNVNVLGLLLTTQ 124 Query: 127 HAVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNAL 186 A + E G +++I S+ R+ + Y ATK A+ + L+ ELG IRVNAL Sbjct: 125 AAAKHMGEG--GSIINIGSLVTRIVPPGGSVYTATKGAVDAITGVLSRELGPRKIRVNAL 182 Query: 187 LPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAAR 246 PG+VE +G + A G ++ QE + L R+ +D+A +A+FL S + Sbjct: 183 NPGMVE---TEGTVTA-----GFIGSDFHQEAIAHTPLGRIGQPQDIATIAVFLASDDSY 234 Query: 247 NVTGQAISVDG 257 +TG+ + G Sbjct: 235 WLTGEKLYAAG 245 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 248 Length adjustment: 24 Effective length of query: 238 Effective length of database: 224 Effective search space: 53312 Effective search space used: 53312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory