Align asparaginase (EC 3.5.1.1) (characterized)
to candidate N515DRAFT_1171 N515DRAFT_1171 L-asparaginase
Query= BRENDA::Q66CJ2 (345 letters) >FitnessBrowser__Dyella79:N515DRAFT_1171 Length = 337 Score = 201 bits (511), Expect = 2e-56 Identities = 124/334 (37%), Positives = 188/334 (56%), Gaps = 12/334 (3%) Query: 22 ALPNITLLATGGTIAGGGDSATK-SNYT--AGKLGVDALVEAVPAIKDIANIQGEQVVNI 78 ALP + ++ GGTIA G S+ +Y KL V ++E VP I A ++ Sbjct: 6 ALPRVAIIGCGGTIASLGTSSLDLMDYPEHGSKLDVAQILERVPEIASFAEAIPVPFRSV 65 Query: 79 GSQDMNDDVWLTLA---KKINKDCTKTDGFVITHGTDTLEETAYFLDLTVNCDKPVVIVG 135 GS ++ W L ++++++ + GFVI HGT TLEETA+FL+LT++ ++ VV+ G Sbjct: 66 GSNNLTMADWFELRATLRRLSREQPELAGFVILHGTATLEETAFFLNLTLDIEQTVVLTG 125 Query: 136 AMRPATALGADGPLNLYNAVVVASEADSAKRGVLVAMNDMVFTGRDVVKTNTTSVQTFQS 195 + RP +A+G+D P NL A+ VA +AD+ RGVLV ND ++ RDV+K +T + TF+S Sbjct: 126 SQRPLSAVGSDAPANLLGAIRVAGDADARGRGVLVVFNDGIYPARDVIKVSTLRLDTFRS 185 Query: 196 PNTGPLGYIYDGKVNYLHQPAARQ-PAFDISKL---NTLPKVGIIYNYANASDIPAKALI 251 + G LG + ++ Y +P R P + L P+V + Y+Y A D A++ Sbjct: 186 MDHGVLGTVDPDRIRYRRRPEGRHAPGAAFAALPDDAQPPRVDVAYSYVGADDTMIAAVL 245 Query: 252 ADGYQGIVSAGVGNGNLYHTVFDTLATAASHGVAVVRSSRVPSGSTTEGAEIDDAKYGFV 311 A G QGIVSAG+ G + L A + G+AVV+ +R P GS + + DA GF+ Sbjct: 246 AKGAQGIVSAGLAPGLVTKAERIALEAAIASGIAVVQCTRSPLGSVAQRRYLRDA--GFI 303 Query: 312 AAGALNPQKARVLLQLALTQTQKPQEIQKLFHTY 345 A +PQKAR+LL L LT T +++ F T+ Sbjct: 304 AGEDFSPQKARILLALGLTLTHDLDTLREHFATH 337 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 337 Length adjustment: 29 Effective length of query: 316 Effective length of database: 308 Effective search space: 97328 Effective search space used: 97328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory