Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate N515DRAFT_1253 N515DRAFT_1253 2-dehydro-3-deoxy-L-fuconate dehydrogenase (EC 1.1.1.-)
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >FitnessBrowser__Dyella79:N515DRAFT_1253 Length = 248 Score = 118 bits (296), Expect = 1e-31 Identities = 81/248 (32%), Positives = 130/248 (52%), Gaps = 11/248 (4%) Query: 12 GLRVFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLHAGIADVSKQAQ 71 G V+A AGIG A A AF A V D+++ A+ ++ P+L DV+ Q Sbjct: 7 GKHALVTAAGAGIGRATALAFAREGARVLATDIDEQALAALSAEAPELRTERLDVTDPVQ 66 Query: 72 VDQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYFLRKAVPV 131 +D+++ DVL N AG G + + D A W+ + + N++S F+ ++ +P Sbjct: 67 IDRLVASHPP----FDVLFNCAGYVH-AGTILDTDDAAWKRSFAINVDSMFHLCQRVLPA 121 Query: 132 LKETSDCASIIAMSSVAGRL-GYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVNAILPG 190 + E SI+ MSSVA + G P R Y++TK A++GL KS+AA+ +R NAI PG Sbjct: 122 MLERGG-GSIVNMSSVASSIKGVPNRFAYSTTKAAVIGLTKSVAADFVGRGIRCNAICPG 180 Query: 191 VVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPAGSNVT 250 V+ + R ALG +A+ ++++ + R+ ++IA +AL+LAS + T Sbjct: 181 TVKTPS----LGDRVRALGGDEDAVWRGFVERQPMGRLGNPEEIAMLALYLASDEAAFTT 236 Query: 251 GQAISVDG 258 G VDG Sbjct: 237 GTVHIVDG 244 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 248 Length adjustment: 24 Effective length of query: 239 Effective length of database: 224 Effective search space: 53536 Effective search space used: 53536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory