Align Glucose kinase (characterized, see rationale)
to candidate N515DRAFT_1256 N515DRAFT_1256 glucokinase
Query= uniprot:Q8P6S9 (338 letters) >FitnessBrowser__Dyella79:N515DRAFT_1256 Length = 330 Score = 268 bits (684), Expect = 2e-76 Identities = 158/330 (47%), Positives = 204/330 (61%), Gaps = 8/330 (2%) Query: 7 MEAVAFPRPETFVAADVGGTHVRLALACESNDPRKPVTVLDYRKYRCADYPGLAEIMAAF 66 M A A RP F+AADVGGTH RLAL N PV V YR +RC ++ A I+ AF Sbjct: 1 MTAHASRRP--FLAADVGGTHARLALMAPGNRGGGPV-VQAYRIFRCGEHASFAAIVRAF 57 Query: 67 FAELSCAPVRRGVIASAGYALEDGRVITANLPWVLAPEQIRQQLGMQALHLVNDFEAVAY 126 L P R V+A G A E G +I +LPW + P + +L + +HL+NDF A+ + Sbjct: 58 LDGLGSRP-RELVLACTGCAHE-GVLINESLPWRIEPAALAAELRLDEVHLLNDFVALTH 115 Query: 127 AANYMTGNQVMQLSGPAQGA--PGPALVLGPGTGLGAALWIPNGGNSVVLPTEAGHAALA 184 AA Y+ + L PA+ A PGP +V+GPGTGLGAA+ +P G SVVLP+EAG LA Sbjct: 116 AAPYIDTARSPLLHAPARAASAPGPIVVVGPGTGLGAAVRLP-GSPSVVLPSEAGQMQLA 174 Query: 185 AASDLEVALLQELRRTRTHVATEHFLSGPGLLTLYTALATLRDAPAVHATPAAVTAAALA 244 A E +++ L TH++ E LSGPG+L +Y AL + A PAAVTAAA+ Sbjct: 175 ARVGREQDVMRLLAGRDTHISYEAVLSGPGVLRVYEALCREQGKVPACAEPAAVTAAAIE 234 Query: 245 GDDVLAHEALQTFCGFMGSVVGDMMLLYGVRSGVYLAGGFLPQIADFIARSDFAARLLDK 304 G D A E L FCG++GS GD+ +LY G+YLAGGFL ++A ++ S F R LDK Sbjct: 235 GSDPRARETLDLFCGWLGSFAGDLAMLYQATGGIYLAGGFLSRLAGYVRGSSFLERFLDK 294 Query: 305 GPLRPALEQVPVRIVEHGQLGVIGAASWFL 334 G +RP L+ VPVR+V+HGQLGVIGAASW L Sbjct: 295 GVMRPFLDNVPVRVVDHGQLGVIGAASWLL 324 Lambda K H 0.321 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 330 Length adjustment: 28 Effective length of query: 310 Effective length of database: 302 Effective search space: 93620 Effective search space used: 93620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory