Align ATPase (characterized, see rationale)
to candidate N515DRAFT_1562 N515DRAFT_1562 sulfate transport system ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Dyella79:N515DRAFT_1562 Length = 384 Score = 152 bits (385), Expect = 8e-42 Identities = 95/230 (41%), Positives = 135/230 (58%), Gaps = 10/230 (4%) Query: 35 FQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSHDRRDIA 94 F AL SL + GE V ++GPSGSGKS+ LR L L+ RG++ +G D + Sbjct: 15 FAALDDFSLDIAEGEFVALLGPSGSGKSSLLRILAGLDDPDRGDVLRDGT----DLLALP 70 Query: 95 TIRQEVGMVFQQFNLFPHLTVLQNL---MLAPVQVRRWPVAQAEATARQLLERVRIAEQA 151 R+++G+VFQ + LFPH+TV N+ + + RR A LL RV++ E Sbjct: 71 AQRRDIGLVFQHYALFPHMTVADNIAFGLRVRPRARRPSRRDIAARVEDLLRRVQLEELG 130 Query: 152 DKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDV-MRDL-ASEGMT 209 +YP QLSGGQ+QRVA+ARALA++P +LL DEP ALD + VR L V +RDL S G+T Sbjct: 131 RRYPTQLSGGQRQRVALARALAVEPSLLLLDEPFGALDAQ-VRGTLRVWLRDLQRSLGLT 189 Query: 210 MLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQ 259 ++ TH+ A E+ADRVV+M G+I + P + P + F+ + Sbjct: 190 TVLVTHDQDEALELADRVVVMNRGRIEQVGAPSEIYREPATPFVHGFVGR 239 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 384 Length adjustment: 27 Effective length of query: 234 Effective length of database: 357 Effective search space: 83538 Effective search space used: 83538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory