Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate N515DRAFT_1583 N515DRAFT_1583 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__Dyella79:N515DRAFT_1583 Length = 334 Score = 84.0 bits (206), Expect = 4e-21 Identities = 58/186 (31%), Positives = 87/186 (46%), Gaps = 8/186 (4%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAG-----VADV 66 G+ LI+G +GIG A+A F GA+V I ++ + H + G DV Sbjct: 91 GMATLITGGDSGIGRAVAVLFAREGADVGIVYLESSDDAEETRRHVEQEGGRCLLIQGDV 150 Query: 67 SDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLR 126 +D + +++ + G LD+L+NNA +ED+ + T TNL F+ R Sbjct: 151 TDPDFCQQAVEETVEEFGHLDVLVNNAAFQEHADTLEDITEEHMDLTFRTNLYGYFHMAR 210 Query: 127 KAVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNA 186 A+P +K A II S G G Y+A+K AI +SL+ L +RVNA Sbjct: 211 AALPHMK---AGASIINTGSETGLFGNPKLLDYSATKGAIHAFTRSLSANLVKKGIRVNA 267 Query: 187 ILPGVV 192 + PG V Sbjct: 268 VAPGPV 273 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 334 Length adjustment: 26 Effective length of query: 237 Effective length of database: 308 Effective search space: 72996 Effective search space used: 72996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory