Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate N515DRAFT_2198 N515DRAFT_2198 Tropinone reductase 1
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2119 (272 letters) >FitnessBrowser__Dyella79:N515DRAFT_2198 Length = 280 Score = 128 bits (321), Expect = 2e-34 Identities = 87/251 (34%), Positives = 128/251 (50%), Gaps = 8/251 (3%) Query: 18 RLKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQGEKVEKVAAHWRDQ--GADVVAI 75 +L+ L+TGA++GIG A+ A A L++ + +E+V D +V+A Sbjct: 29 QLQGHTALITGASKGIGYAVARELAGLGANLLLVARDDDHLEQVRVELADDFDHIEVLAF 88 Query: 76 KADVSRQQDLHAMARLAIDLHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWY 135 AD+S Q+D A+ DL + +LVN AG N LE +E D+R F ++L A+ Sbjct: 89 AADLSMQEDRLAVFDWIADLGAPLSLLVNNAGGNTPAAVLEYSERDYRAIFELNLFSAFE 148 Query: 136 GCKAVLPQMIEQGIGSIINIASTHS-THIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVR 194 C+ PQ+++ +I+N+ S TH+ G Y ++K L LTR L E+A G+R Sbjct: 149 MCRLAHPQLVQHANAAIVNVGSVSGITHVRTGA-AYGMSKAALHQLTRNLAAEWATDGIR 207 Query: 195 VNAIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPF 254 VNA+AP YI TQ + AD D P RRIG+P EVA FL A + Sbjct: 208 VNAVAPWYIRTQRSEP---ALADDE-YLDEVLDHTPLRRIGEPEEVAAAIAFLCLPAASY 263 Query: 255 INASCITIDGG 265 I + +DGG Sbjct: 264 ITGQVLAVDGG 274 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 280 Length adjustment: 25 Effective length of query: 247 Effective length of database: 255 Effective search space: 62985 Effective search space used: 62985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory