Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate N515DRAFT_2216 N515DRAFT_2216 cell division transport system ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__Dyella79:N515DRAFT_2216 Length = 225 Score = 136 bits (342), Expect = 5e-37 Identities = 82/225 (36%), Positives = 130/225 (57%), Gaps = 12/225 (5%) Query: 27 LQVEGIHKRY-GEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITL 85 ++ + + KRY G HE L +S G++ + G SG+GKST+L+ + +E+P G I+L Sbjct: 2 IRFDQVSKRYEGGHEALSQLSFQVAPGEMAFVTGHSGAGKSTLLKLLGLIERPSHGSISL 61 Query: 86 DGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSA 145 DG S+ + GR G + LR R+ MVFQ L TV N+ + P + V+ Sbjct: 62 DGQSLA-KIGRGG--------IPKLRRRIGMVFQDHRLLMDRTVFANVEL-PLVIGGVAP 111 Query: 146 AEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDP 205 AE +R R L+KVGL + Q PA LS G+QQRV IARA+ +P +++ DEPT LDP Sbjct: 112 AERGRRVRAALEKVGLLA-YERQLPATLSTGEQQRVGIARAIVAKPTLLIADEPTGNLDP 170 Query: 206 ELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRV 250 +L E++ + + G T+L+ +H++ +++ +V+ L GR+ Sbjct: 171 QLAVEIMGLFAEFQQVGTTVLVASHDLPLIKRMRKRVVVLDHGRL 215 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 225 Length adjustment: 24 Effective length of query: 252 Effective length of database: 201 Effective search space: 50652 Effective search space used: 50652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory