Align 2-dehydro-3-deoxygluconokinase (EC 2.7.1.45) (characterized)
to candidate N515DRAFT_2221 N515DRAFT_2221 2-dehydro-3-deoxygluconokinase
Query= reanno::Cup4G11:RR42_RS28860 (311 letters) >FitnessBrowser__Dyella79:N515DRAFT_2221 Length = 311 Score = 386 bits (992), Expect = e-112 Identities = 199/296 (67%), Positives = 220/296 (74%) Query: 4 DILAFGEALVEFNQQPDDPSRYLQGFGGDTSNFCIAAARQGARAGYISAVGEDTFGERLL 63 +IL+FGE L EFNQ + + G+GGDTSNFCIAAARQGA YISA G+D FG+ L Sbjct: 5 EILSFGEPLAEFNQTQAGSAAWRLGYGGDTSNFCIAAARQGASVDYISATGDDRFGQGLR 64 Query: 64 ALWTQERVDTRHVRIDAGAPTGVYFVTHDAHGHRFDYLRSGSAASHYSHENLPHHAIAEA 123 LW E V HVR D APTGVYFV+HDA GH FDYLR+GSAAS Y LP AIA A Sbjct: 65 DLWQAEGVGHSHVRTDPQAPTGVYFVSHDASGHHFDYLRAGSAASRYVPAYLPGQAIASA 124 Query: 124 RYLHVSGISLAISTSACDAGLAAMEHARKAGCQVTLDTNLRLRLWTLARARGIMREAFAL 183 R LH+SGISLAIS ACDAGL AM AR AG V+ DTNLRLRLW LARAR +MREA L Sbjct: 125 RALHLSGISLAISQDACDAGLEAMAQARAAGVMVSFDTNLRLRLWPLARARAVMREALRL 184 Query: 184 TDVCLPSWDDITVLTGLDDRDAIVDYLLGCGIGLVALKLGEEGAYVATPEARTLVPPYTV 243 D+CLPSWDDIT + + DAI+D LL CGI LVALK+G G YVATPE+R LVPP+ V Sbjct: 185 CDLCLPSWDDITAVLDCHEPDAILDTLLDCGIELVALKMGARGCYVATPESRILVPPHAV 244 Query: 244 RPVDATGAGDCFGGSFVARLAAGDDPFDAARYANVAAALSTTGYGAVAPIPSIETV 299 VDATGAGDCFGG+FVARL AGDD AARYANVAAALSTTGYGA+A IP E V Sbjct: 245 DAVDATGAGDCFGGAFVARLVAGDDAVAAARYANVAAALSTTGYGAIASIPRAEAV 300 Lambda K H 0.321 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 311 Length adjustment: 27 Effective length of query: 284 Effective length of database: 284 Effective search space: 80656 Effective search space used: 80656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory