Align ATPase (characterized, see rationale)
to candidate N515DRAFT_2392 N515DRAFT_2392 putative ABC transport system ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Dyella79:N515DRAFT_2392 Length = 254 Score = 140 bits (352), Expect = 3e-38 Identities = 86/209 (41%), Positives = 121/209 (57%), Gaps = 3/209 (1%) Query: 37 ALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSH-DRRDIAT 95 AL V L++ RGE V + GPSG GK+T L L L++ G + GH ++ + A Sbjct: 26 ALSDVHLSIARGEYVSISGPSGCGKTTLLSILGLLDTATSGSFVLNGHDVATLNAAQRAR 85 Query: 96 IRQ-EVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKY 154 IR E+G +FQ FNL L+V +N+ L A+ A ++ LERV +A + Y Sbjct: 86 IRNAEIGFIFQAFNLIGDLSVQENVELPLTYRSSIGAAERRARVQEALERVGMAHRMRHY 145 Query: 155 PGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLASEGMTMLVAT 214 P QLSGGQQQRVA+ARAL +P ILL DEPT LD V+ ++ +L G T+ + T Sbjct: 146 PAQLSGGQQQRVAVARALVGRPAILLADEPTGNLDSRNGEAVMSLLDELHKGGATICMVT 205 Query: 215 HEVGFAREVADRVVLMADGQIVEEAPPDR 243 H+ +A E+A R V + DG++V+E DR Sbjct: 206 HDARYA-ELAQRKVRLFDGRVVDEETFDR 233 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 254 Length adjustment: 24 Effective length of query: 237 Effective length of database: 230 Effective search space: 54510 Effective search space used: 54510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory