Align 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA acyltransferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; EC 2.3.1.16 (characterized)
to candidate N515DRAFT_2688 N515DRAFT_2688 acetyl-CoA acyltransferase
Query= SwissProt::P09110 (424 letters) >FitnessBrowser__Dyella79:N515DRAFT_2688 Length = 401 Score = 311 bits (798), Expect = 2e-89 Identities = 184/395 (46%), Positives = 250/395 (63%), Gaps = 13/395 (3%) Query: 37 DVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDV-NLRPEQLGDICVGNVL-QP 94 D +V RT + +A RG F++T PD++L+ V+ AV+ + ++GD+ VG + + Sbjct: 7 DAYIVAATRTPVGKAPRGVFRNTRPDDMLAHVIRAVMAQAPGIDAHRIGDVIVGCAMPEA 66 Query: 95 GAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMS 154 G +ARI L+ +P+TVP TVNR CSSG+QA+A A IR G D+ +A G ESMS Sbjct: 67 EQGMNVARIGLLLAGLPDTVPGVTVNRFCSSGVQAIAQAADRIRLGEADLMIAAGTESMS 126 Query: 155 LADR-GNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARA 213 + G+ + + + E MGIT+ENVA+++ ISRE+QDTFA AS ++A A Sbjct: 127 MVPMMGHKVAMNPGIFDNEHI-GIAYGMGITAENVAKQWKISREEQDTFAAASHERALAA 185 Query: 214 QSKGCFQAEIVPVTTTVHDDKGTKRSIT-----VTQDEGIRPSTTMEGLAKLKPAFKKD- 267 G F+ EI P H RSI + DEG RP +T+E L KLKP F+ Sbjct: 186 IKAGEFKDEITPFKLDDHYPDLATRSIKTDSRLIDTDEGPRPGSTVEVLGKLKPVFRNGQ 245 Query: 268 --GSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAI 325 GS TAGNSSQ SDGA A+LLA + +E GL + SY+V GV PDIMGIGP AI Sbjct: 246 FGGSVTAGNSSQTSDGAGAVLLASEAAIKEYGLTPIARFVSYSVAGVRPDIMGIGPKEAI 305 Query: 326 PVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGAR 385 P AL++AG+T +D E+NEAFA+Q+ ++ L L P K+NPLGGA+ALGHPLG TGA Sbjct: 306 PKALKQAGMTQDQLDWIELNEAFAAQSLAVIKDLGLDPSKINPLGGAIALGHPLGATGAI 365 Query: 386 QVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE 420 + TL++ ++RR K+ YG+V+MCIGTGMGAA +FE Sbjct: 366 RAATLVHGMRRR-KQKYGMVTMCIGTGMGAAGIFE 399 Lambda K H 0.317 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 401 Length adjustment: 31 Effective length of query: 393 Effective length of database: 370 Effective search space: 145410 Effective search space used: 145410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory