Align Fructokinase-1; Fructokinase I; OsFKI; EC 2.7.1.4 (characterized)
to candidate N515DRAFT_3101 N515DRAFT_3101 ribokinase
Query= SwissProt::Q0JGZ6 (323 letters) >FitnessBrowser__Dyella79:N515DRAFT_3101 Length = 297 Score = 84.0 bits (206), Expect = 4e-21 Identities = 95/320 (29%), Positives = 134/320 (41%), Gaps = 40/320 (12%) Query: 4 RSELVVSFGEMLIDFVPTVAGVS-LAEAPAFVKAPGGAPANVAIAVARLGGGAAFVGKLG 62 R +V S L+ P AG F+ PGG AN A+A ARLG +G LG Sbjct: 3 RVVVVGSINMDLVTLAPRFAGPGETVLGERFLTVPGGKGANQAVAAARLGAEVTLIGALG 62 Query: 63 DDEFGRMLAAILRDNGV--DDGGVVFDAGARTALAFVTLRADGEREFMFYRNPSADMLLT 120 DD FG L L G+ D + D G+ TA V A GE E + +A + Sbjct: 63 DDTFGEQLREGLAREGIALDYVSRIDDCGSGTASITV---AGGENEIIVVPAANARVTPA 119 Query: 121 HAELNVELIKRAAVFHYGSISLIAEPCRSAHLRAMEI---AKEAGALLSYDPNLREALWP 177 E + I RA A L MEI + EA L + + L P Sbjct: 120 QVEAATDAIARA----------------DAVLVQMEIPLESVEATLRLGHRLGVPVILNP 163 Query: 178 SREEARTKILSIW-DQADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQG 236 + + K+ + W A V ++ EL L G D+ +D L R +++T G +G Sbjct: 164 APAQ---KLPTEWLKLARYVTPNQHELAILLGADAQQD--FRALMRQAPGPVVLTRGGEG 218 Query: 237 CKYYARDFRGAVPSYKVQQVDTTGAGDAFVGALLRRIVQDPSSLQDQKKLEEAIKFANAC 296 Y + V VDTTGAGD F GAL ++ + L +A++ A A Sbjct: 219 AWYREDGEPTHQSGFAVDVVDTTGAGDTFNGAL---------AVFLHEGLPQAVRKACAA 269 Query: 297 GAITATKKGAIPSLPTEVEV 316 A++ T+ GA +PT VE+ Sbjct: 270 AALSVTRLGAQGGMPTRVEL 289 Lambda K H 0.320 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 297 Length adjustment: 27 Effective length of query: 296 Effective length of database: 270 Effective search space: 79920 Effective search space used: 79920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory