Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate N515DRAFT_3630 N515DRAFT_3630 4-aminobutyrate aminotransferase
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__Dyella79:N515DRAFT_3630 Length = 469 Score = 211 bits (538), Expect = 3e-59 Identities = 152/434 (35%), Positives = 228/434 (52%), Gaps = 29/434 (6%) Query: 37 PIVIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFY 96 P + G+G +YD G F D +N G+ + R+ + +K Q + + + + + Sbjct: 38 PKIFRHGQGSWMYDTAGVPFLDLQMWYSAVNFGYGNKRLNDTLKAQIDTLPQVA-SQYLH 96 Query: 97 ENAIILAEKLIELAPGD--IERKVVYGNSGAEANEAAMKLVK-YGTGRKQFLAFYHAFHG 153 + I LA+ + A ++ +V + GA+A E ++KLV+ Y G+ AF +HG Sbjct: 97 QTRIELAKTIAVDAQQKFGLKGRVHFNVGGAQAVEDSLKLVRNYKNGKSLMFAFEGGYHG 156 Query: 154 RTQAVLSLTAS-KWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIE 212 RT S+T+S ++ ++ G F IP+P P+R G+ E D + E Sbjct: 157 RTLGASSITSSYRYRRRFGHFGER--AMFIPFPYPFRRPKGMTPEEYSDACVRQFERLFE 214 Query: 213 -EYVFRHVPP---HEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMG 268 EY P E A + EPIQG GGYV+PPK FFK LKK D+YGIL+ DE+QMG Sbjct: 215 TEYNGVWDPKVNQAEYAAFYVEPIQGTGGYVIPPKNFFKDLKKVLDKYGILMVVDEIQMG 274 Query: 269 IGRTGKFWAIEHFGVEPDLIQFGKAIGGGL-PLAGVIHRADITFDK---PGRHATTFGGN 324 RTGK W+IEHFGV PD+I FGKA+ GL PL+G+ R ++ + PG +TF N Sbjct: 275 FWRTGKLWSIEHFGVTPDIIVFGKALTNGLNPLSGLWAREEMINPEIFPPGSTHSTFNSN 334 Query: 325 PVAIAAGIEVVEIVKEL--LPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVK 382 P+ + G+EV+++ EL +V + G + L++ +++++ IGD GLGLA EI Sbjct: 335 PLGTSLGLEVIKMGYELDYETNVAKKGAHFLDALKDLQKRHKEIGDVDGLGLALRAEIC- 393 Query: 383 SKETKEKYPELRDRIV---------KESAKRGLVL--LGCGDNSIRFIPPLIVTKEEIDV 431 + + L DR+V K GLVL G N I F P L +T EEID+ Sbjct: 394 TDDGFTPNKALLDRMVDIGLAGDLEHNGKKIGLVLDVGGWYKNVITFAPSLDITHEEIDL 453 Query: 432 AMEIFEEALKAALK 445 A+ + ++ L A K Sbjct: 454 AIALLDQLLTKAKK 467 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 603 Number of extensions: 37 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 469 Length adjustment: 33 Effective length of query: 412 Effective length of database: 436 Effective search space: 179632 Effective search space used: 179632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory