Align Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized)
to candidate N515DRAFT_3653 N515DRAFT_3653 amino acid/polyamine/organocation transporter, APC superfamily (TC 2.A.3)
Query= TCDB::Q2VQZ4 (536 letters) >FitnessBrowser__Dyella79:N515DRAFT_3653 Length = 453 Score = 205 bits (521), Expect = 3e-57 Identities = 137/434 (31%), Positives = 212/434 (48%), Gaps = 14/434 (3%) Query: 33 LKQDLKNRHMQMIAIGGAIGAGLFVGSGGALQKGGPAALLIGYLIIGIMLLCTCLALAEM 92 L++ L RH+ +A+G AIGAGLF+GS A+ GP+ +L YL G M+ AL EM Sbjct: 5 LQRRLTPRHITFMALGMAIGAGLFLGSANAINLAGPS-VLFAYLFGGAMIFIIMRALGEM 63 Query: 93 AVLYPVNGAFFTYIVRFVDPSWGFAMGWQYALAWLTVLPFELIAASITIRFWREDINMAV 152 AV PV G+F TY R++ P G+ GW Y + + V E A I +R W ++ + Sbjct: 64 AVHDPVAGSFSTYAHRYLGPFAGYLTGWNYWILMVGVGMAESTAVGIYMRQWFPELPQWI 123 Query: 153 WVSVFLVVLMGIQIFGVRGYGEVEFVLSIIKICACVGFIILGIVINCGGVGDQGY-IGV- 210 WV + ++ G+ + V+ YGE+EF ++IK+ V I+ G + G G+ G +G+ Sbjct: 124 WVFGSVAMIGGLNLMAVKVYGEMEFWFTLIKVVTVVLMILGGAGMIWLGWGNGGQPVGLA 183 Query: 211 KYWRDPGAFT-SFKGFCAVFVVAAFSFGGTEMVGLAAAESANPRKSIPMASKQVFWRIAI 269 W G F F G V F+FGG E +G+AA E+A P ++IP A V WRI I Sbjct: 184 NLWSHGGWFPHGFTGMVLALPVVVFAFGGIETIGMAAGEAAQPERTIPRAVNSVLWRILI 243 Query: 270 FYILNLFIVGLILPANDPRLMGASGANTKASPFVLAIQDAGIKVLPSIMNAVITVAVLSV 329 FY+ LF++ I P + T+ SPFV GI ++N V+ A LS Sbjct: 244 FYVGALFVIMAIYPWDQ--------LGTQGSPFVTTFGKLGIPQAAGLINFVVITAALSG 295 Query: 330 ANSCTFGSTRTIQAMAERNMAPNFFKYIDSKGRPLYCVILQIAFGLLAYIGAAPQGMEIF 389 NS TF +R + +++ + AP F + G P+ V++ +A + + IF Sbjct: 296 FNSTTFSGSRMLYSLSTKAQAPAFLGQVSEHGVPVRAVLVTLACLVFGVVLNYLLPERIF 355 Query: 390 GWLLALTGLGFLFVWGSICLAHIRMRAGMKAQGINLGLIPYKTPFGVAGSYLGLGLNILA 449 ++++ ++ W + +AH R A L P + V +L L +L Sbjct: 356 AMMMSILAFNTVWTWMMVLIAHYSFRRRHGATAFPLRAWPLTSV--VCLLFLAFVLFMLG 413 Query: 450 LIASFYTALFPASG 463 A AL+ +G Sbjct: 414 YSADTRVALYVGAG 427 Lambda K H 0.327 0.142 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 658 Number of extensions: 41 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 536 Length of database: 453 Length adjustment: 34 Effective length of query: 502 Effective length of database: 419 Effective search space: 210338 Effective search space used: 210338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory