Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate N515DRAFT_4212 N515DRAFT_4212 multiple sugar transport system ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__Dyella79:N515DRAFT_4212 Length = 364 Score = 213 bits (542), Expect = 6e-60 Identities = 134/353 (37%), Positives = 192/353 (54%), Gaps = 27/353 (7%) Query: 1 MARISLDLAHSYKPNPQQDSDYALLPLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVP 60 MA++ LD PN + E DG L+GPSGCGKTT+L +++GL Sbjct: 1 MAKVRLDKLRKVYPN----GHVGVAEASFEIADGELLVLVGPSGCGKTTLLRMIAGLESI 56 Query: 61 SHGKVLFDGRDVTRASPQERNIAQVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVG 120 S G + R V +P++R+IA VFQ +Y MTVAENL F L+ R P+ +I++RV Sbjct: 57 SGGTLSIGERVVNDIAPKDRDIAMVFQNYALYPHMTVAENLGFGLKLRGQPKAEIERRVA 116 Query: 121 VIAEMLEMSGQLNQRAAGLAADAKQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRR 180 A MLE+ +L+ R A L+ +Q+++LGR LVR D L DEPL+ +D L+ +R Sbjct: 117 EAARMLELEQRLDSRPAALSGGQRQRVALGRALVR-DPKVFLLDEPLSNLDAKLRLSMRV 175 Query: 181 KLKQIHHELKLTLIYVTHDQVEALTFADQVVVMTRGKAVQVGSADALFERPAHTFVGHFI 240 ++ +IH LK T++YVTHDQ+EA+T ++VV+ G Q+ + L++ PA+ FV F+ Sbjct: 176 EIARIHQRLKATMVYVTHDQIEAMTLGQRIVVLNGGVIQQIDTPMNLYDTPANLFVAGFL 235 Query: 241 GSPGMNFLPA--HRDGENLSVAGHRLASPVGR----ALPAGA---------LQVGIRPEY 285 GSP MN L +RDG G +LA P G LP GA + VG+RPE Sbjct: 236 GSPAMNLLRGILYRDG------GWKLAMPQGELVLGELPQGAALEAWRDRDIVVGLRPED 289 Query: 286 LALAQPQQAGALPGTVVQVQDIGTYQMLTAKVGEHTVKARFTPETRLPSSGDT 338 L L AL + V+ +G L + GE + +R P LP+ G T Sbjct: 290 LLLCADAAGAALAAQLEVVEPVGNEVFLNLRHGELALVSRMPPR-ELPAPGST 341 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 364 Length adjustment: 29 Effective length of query: 329 Effective length of database: 335 Effective search space: 110215 Effective search space used: 110215 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory