Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate N515DRAFT_4212 N515DRAFT_4212 multiple sugar transport system ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__Dyella79:N515DRAFT_4212 Length = 364 Score = 298 bits (763), Expect = 2e-85 Identities = 171/367 (46%), Positives = 232/367 (63%), Gaps = 11/367 (2%) Query: 1 MTGLLLKDIRKSY--GAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGG 58 M + L +RK Y G V V +I +GE +V VGPSGCGK+TLLRMIAGLE I+GG Sbjct: 1 MAKVRLDKLRKVYPNGHVGVAEA-SFEIADGELLVLVGPSGCGKTTLLRMIAGLESISGG 59 Query: 59 DMFIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAA 118 + I VND+ P R IAMVFQ+YALYPHMTV +N+ FG+++ + K EI+RRV AA Sbjct: 60 TLSIGERVVNDIAPKDRDIAMVFQNYALYPHMTVAENLGFGLKLRGQPKAEIERRVAEAA 119 Query: 119 DMLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAK 178 ML+L LD P ALSGGQRQRVA+GRA+ R+PKVFL DEPLSNLDA LR++ R+EIA+ Sbjct: 120 RMLELEQRLDSRPAALSGGQRQRVALGRALVRDPKVFLLDEPLSNLDAKLRLSMRVEIAR 179 Query: 179 LSERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSP 238 + +R+ TM+YVTHDQ+EAMTL RIVVL+ G I+Q+ P+ LY+ PANLFVA F+GSP Sbjct: 180 IHQRLK-ATMVYVTHDQIEAMTLGQRIVVLNGGVIQQIDTPMNLYDTPANLFVAGFLGSP 238 Query: 239 AMNVIPATITATGQQTAVSLAGGKSVTLDVPTNASENG---KTASFGVRPEDLRV-TEAD 294 AMN++ + G +++ G+ V ++P A+ + G+RPEDL + +A Sbjct: 239 AMNLLRGILYRDG-GWKLAMPQGELVLGELPQGAALEAWRDRDIVVGLRPEDLLLCADAA 297 Query: 295 DFLFEGTVSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFD 354 + +VE +G L + ++++MP G + F +LH FD Sbjct: 298 GAALAAQLEVVEPVGNEVFLNLRH--GELALVSRMPPRELPAPGSTLHFGFAPERLHFFD 355 Query: 355 TNGQSYR 361 G+ R Sbjct: 356 AKGEGAR 362 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 364 Length adjustment: 29 Effective length of query: 333 Effective length of database: 335 Effective search space: 111555 Effective search space used: 111555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory