Align L-tyrosine transporter (characterized)
to candidate NP_347363.1 CA_C0727 amino acid permease
Query= reanno::pseudo5_N2C3_1:AO356_18530 (471 letters) >NCBI__GCF_000008765.1:NP_347363.1 Length = 460 Score = 363 bits (933), Expect = e-105 Identities = 194/463 (41%), Positives = 284/463 (61%), Gaps = 16/463 (3%) Query: 10 ELKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAICGFIAFMIMRQLGEM 69 EL RGLK RHI+LIALGG IG GLF+GSA +K AGPS++L Y + G ++IMR +GEM Sbjct: 5 ELSRGLKARHIELIALGGTIGVGLFMGSASTIKWAGPSVLLAYGVAGIAMYIIMRIMGEM 64 Query: 70 IVEEPVAGSFSHFAHKYWGGFAGFLSGWNCWILYILVGMSELTAVGKYIHYWAPDIPTWV 129 + EP+AGSF+++A+KY AG+++ W W ++I VGMSE+TA+G Y+ +W P +P W+ Sbjct: 65 LYLEPLAGSFANYANKYISPLAGYITAWCYWFMWIAVGMSEITAIGIYVKFWFPALPAWI 124 Query: 130 SAAAFFILINAINLANVKVFGEAEFWFAIIKVVAIVGMIALGSYLLVSGHG--GPQASVT 187 A ++ A N+A+VK +GE EFWF++IKVV IV M+ +G L+ G G G Sbjct: 125 PALIGVAILAAANMASVKFYGEFEFWFSLIKVVTIVVMLIVGVGLIFFGIGNHGVPIGFK 184 Query: 188 NLWSHGGFFPNGVSGLVMAMAIIMFSFGGLEMLGFTAAEADKPKTVIPKAINQVIYRILI 247 NL +HGGFF G+ G + A+ ++ S+ G+E++G TA EA PK + KA +I+RILI Sbjct: 185 NLTAHGGFFAGGLKGWLFALCMVTASYQGVELIGITAGEAQDPKNTLRKATKNIIWRILI 244 Query: 248 FYIGALVVLLSLTPWDSLLATLNASGDAYSGSPFVQVFSMLGSNTAAHILNFVVLTAALS 307 FY+GA+ V++++ PWD ++TL GSP V F+ +G AA I+NFVVLTAA+S Sbjct: 245 FYVGAIFVIVTIYPWDK-ISTL--------GSPSVLTFAKIGIAAAAGIINFVVLTAAMS 295 Query: 308 VYNSGTYCNSRMLLGMAEQGDAPKALSRIDKRGVPVRSILASAAVTLVAVLLNYLVPQHA 367 NSG Y RML +A G APK L +++K GVP I + L+ V+LNY+ P Sbjct: 296 GCNSGIYSCGRMLYTLATNGQAPKFLGKLNKDGVPANGIRTTLVCLLIGVILNYIYPNSK 355 Query: 368 LEL-LMSLVVATLVINWAMISYSHFKFRQHMNQTQQTPLFKALWYPYGNYICLAFVVFIL 426 L + + S V + W ++ S KFR+ + + FK+ +PY NYI +A++ +L Sbjct: 356 LFVYIYSASVLPGMAPWFVLCISQIKFRKEHAEEMKMHPFKSRLFPYANYIVVAYLCLVL 415 Query: 427 GVMLLIPGIQISVYAIPVWVVFMWVCY----VIKNKRSARQEL 465 M QI ++ V+ + + Y + K K S +EL Sbjct: 416 IGMCFNSSTQIPLFIGAVFCAIVTIAYFAFGIHKGKVSKVEEL 458 Lambda K H 0.327 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 471 Length of database: 460 Length adjustment: 33 Effective length of query: 438 Effective length of database: 427 Effective search space: 187026 Effective search space used: 187026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory