Align D/L-lactic acid transporter; Lactate racemization operon protein LarD; Lactic acid channel (characterized)
to candidate NP_347948.1 CA_C1319 glycerol uptake facilitator protein
Query= SwissProt::F9UST3 (238 letters) >NCBI__GCF_000008765.1:NP_347948.1 Length = 233 Score = 176 bits (447), Expect = 3e-49 Identities = 94/225 (41%), Positives = 136/225 (60%), Gaps = 7/225 (3%) Query: 7 AEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTWGFGISVALFIFGNVC--INPA 64 AE +GT L+I+ G GV + VLK +K SG I W F +++ IFG+ NPA Sbjct: 6 AELVGTLLLILLGDGVVANVVLKNSKGHASGWIVITMGWAFAVAIPALIFGSYSNQFNPA 65 Query: 65 MVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYADHFKASTDEISPITIRNLFCT 124 + +A ++G +AW+ Y + +G +G+V+V+++Y D FK S ++ + + FCT Sbjct: 66 LTIALAVIGKVAWAKVPIYLAGQFIGAFLGAVLVFVVYYDQFKCSENKTDKLGV---FCT 122 Query: 125 APAVRNLPRNFFVELFDTFIFISGILAI-SEIKTPGIVPIGVGLLVWAIGMGLGGPTGFA 183 PAVRN NF E+ TF+ + GIL + ++ G+ + VG L+ IG+ LGGPTG+A Sbjct: 123 VPAVRNSLINFLCEVIGTFVLVFGILGVGAQNLKNGMGAVFVGFLILVIGLSLGGPTGYA 182 Query: 184 MNLARDMGPRIAHAILPIANKADSDWQYGIIVPGIAPFVGAAIAA 228 +N ARD+ PRIAH +LPI NK DS+W Y I P IAP VG I A Sbjct: 183 INPARDLAPRIAHLVLPIPNKGDSNWSYAWI-PIIAPVVGGIIGA 226 Score = 26.2 bits (56), Expect = 6e-04 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 21/108 (19%) Query: 6 IAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTWGFGISVALFIFGN---VCIN 62 + E +GT +++ +GV ++ G G +F GF I V G IN Sbjct: 134 LCEVIGTFVLVFGILGVGAQNLKNGM-----GAVFV----GFLILVIGLSLGGPTGYAIN 184 Query: 63 PAMVLAQCLL---------GNIAWSLFIPYSVAEVLGGVVGSVIVWIM 101 PA LA + G+ WS +A V+GG++G+V ++ Sbjct: 185 PARDLAPRIAHLVLPIPNKGDSNWSYAWIPIIAPVVGGIIGAVCYMLL 232 Lambda K H 0.330 0.145 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 238 Length of database: 233 Length adjustment: 23 Effective length of query: 215 Effective length of database: 210 Effective search space: 45150 Effective search space used: 45150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory