Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate NP_348203.1 CA_C1576 oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000008765.1:NP_348203.1 Length = 285 Score = 98.6 bits (244), Expect = 1e-25 Identities = 76/255 (29%), Positives = 112/255 (43%), Gaps = 21/255 (8%) Query: 8 VKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKK----LGNNCVFAPA 63 +KG A+ITGG SG+G A + +GA V++ + KK LG C P Sbjct: 40 LKGKTAIITGGDSGIGRAVSVAYAHEGADVVIIYYDEHQDADETKKIIDGLGRKCTLMPG 99 Query: 64 DVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLM 123 D+ A+ + ++D+ VN A + Y + E F R N+ Sbjct: 100 DIGDTNFCNYAIENTIRAYDKIDILVNNAAMQ-----YPQNSIADISNEQFDRTFKTNVY 154 Query: 124 GTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIA 183 GTF + R +M IINT SV AF+G YS +KG I+ T ++ Sbjct: 155 GTFYMTRAAISKMKAGSS--------IINTTSVVAFKGNETLIDYSMTKGAILAFTKSLS 206 Query: 184 RDLAPIGIRVMTIAPGLFGTPLLT-SLPEKVCNFLASQVPFPSRLGDPAEY--AHLVQAI 240 L GIRV +APG TPL++ S E + S VP R G P E A++ A Sbjct: 207 TSLVKSGIRVNAVAPGPIWTPLISASFDENKVSEFGSNVPL-ERPGQPVECAGAYVFLAS 265 Query: 241 IENPFLNGEVIRLDG 255 + ++ G+ I ++G Sbjct: 266 EMSSYITGQTIHVNG 280 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 285 Length adjustment: 25 Effective length of query: 236 Effective length of database: 260 Effective search space: 61360 Effective search space used: 61360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory