Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate NP_349562.1 CA_C2960 UDP-galactose 4-epimerase
Query= SwissProt::Q7WTB1 (330 letters) >NCBI__GCF_000008765.1:NP_349562.1 Length = 329 Score = 371 bits (953), Expect = e-107 Identities = 179/328 (54%), Positives = 235/328 (71%) Query: 1 MKVLVIGGAGYIGSHAVRELVKEGNDVLVLDALYTGHRKAVDPKAKFYQGDIEDTFLVSK 60 M +LV GGAGYIGSH V EL++ G +V+++D L +GH +AV+ KAKFY+GDI D+ + K Sbjct: 1 MSILVCGGAGYIGSHTVHELIESGKEVVIVDNLQSGHLQAVNKKAKFYKGDIRDSEFLDK 60 Query: 61 ILRDEKIDAVMHFAAYSLVPESVKKPLKYYDNNVTGMISLLQAMNDANVKYLVFSSSAAT 120 + + KI +++HFAA SLV ES++KPL Y++NNV GM LL++M N+K +VFSS+AA Sbjct: 61 VFSENKIQSIIHFAANSLVGESMEKPLLYFNNNVYGMQILLESMVKHNIKNIVFSSTAAV 120 Query: 121 YGIPKKLPITEDTPLNPINPYGETKMMMEKIMAWADKADGIKYTALRYFNVAGASSDGSI 180 YG PKK+PI E NP N YGETK+ MEK+M W+ KA GI Y ALRYFNVAGA DGSI Sbjct: 121 YGEPKKIPILESDDTNPTNTYGETKLTMEKMMKWSSKAYGINYVALRYFNVAGALDDGSI 180 Query: 181 GEDHAPETHLIPNILKSAISGDGKFTIFGDDYDTKDGTNVRDYVQVEDLIDAHILALKHM 240 GEDH PETHLIP IL+ + T+FG DY T DGT +RDY+ V DL AHI A++++ Sbjct: 181 GEDHNPETHLIPLILQVPLKKRPFITVFGTDYPTPDGTCIRDYIHVIDLAAAHIKAVEYL 240 Query: 241 MKTNKSDVFNLGTAHGYSNLEILESAKKVTGIDIPYTMGPRRGGDPDSLVADSTKARTVL 300 KS +FNLG G+S E++++A++VT +I +G RR GDP LVA S KA+ VL Sbjct: 241 ENGGKSSIFNLGNGVGFSVKEMIDAAREVTKQNIKVVLGERRSGDPAQLVASSQKAKEVL 300 Query: 301 GWKPKHENVDDVIATAWKWHKSHPKGYE 328 GW PK NV D+I AWKWH++HP G++ Sbjct: 301 GWSPKFTNVKDIIKDAWKWHETHPNGFD 328 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 329 Length adjustment: 28 Effective length of query: 302 Effective length of database: 301 Effective search space: 90902 Effective search space used: 90902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate NP_349562.1 CA_C2960 (UDP-galactose 4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.30577.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-138 447.1 0.1 1.7e-138 447.0 0.1 1.0 1 lcl|NCBI__GCF_000008765.1:NP_349562.1 CA_C2960 UDP-galactose 4-epimera Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008765.1:NP_349562.1 CA_C2960 UDP-galactose 4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 447.0 0.1 1.7e-138 1.7e-138 2 331 .. 3 326 .. 2 327 .. 0.99 Alignments for each domain: == domain 1 score: 447.0 bits; conditional E-value: 1.7e-138 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeekida 73 iLv GgaGyiGsh+v++l e+gkevv++Dnl +g+ +a+++ k+++gd++d+e l++v++e+ki++ lcl|NCBI__GCF_000008765.1:NP_349562.1 3 ILVCGGAGYIGSHTVHELIESGKEVVIVDNLQSGHLQAVNKKA-----KFYKGDIRDSEFLDKVFSENKIQS 69 9**************************************9988.....6*********************** PP TIGR01179 74 viHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesplnpinpY 145 +iHfaa vgEs+++Pl Y++nnv + Lle+m+k+++k+++Fss+aavYge++k+pi E+ +np+n Y lcl|NCBI__GCF_000008765.1:NP_349562.1 70 IIHFAANSLVGESMEKPLLYFNNNVYGMQILLESMVKHNIKNIVFSSTAAVYGEPKKIPILESDDTNPTNTY 141 ************************************************************************ PP TIGR01179 146 GrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkrekleifGtdy 217 G++kl++E+++k +ka +++++v+LRYFnvaGA +g+iGe+++++thli+l+++v + kr+ +++fGtdy lcl|NCBI__GCF_000008765.1:NP_349562.1 142 GETKLTMEKMMKWSSKA-YGINYVALRYFNVAGALDDGSIGEDHNPETHLIPLILQVPLKKRPFITVFGTDY 212 *****************.****************************************************** PP TIGR01179 218 ptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaG 289 pt+DGtc+RDyiHv Dla+aH++a+e+le+gg+s+++nlG+g gfsvke+i+a+++v+ ++ikv l +rR+G lcl|NCBI__GCF_000008765.1:NP_349562.1 213 PTPDGTCIRDYIHVIDLAAAHIKAVEYLENGGKSSIFNLGNGVGFSVKEMIDAAREVTKQNIKVVLGERRSG 284 ************************************************************************ PP TIGR01179 290 DpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331 Dpa+lva+++k+k++lgw+pk++++++iik+aw+W++++++g lcl|NCBI__GCF_000008765.1:NP_349562.1 285 DPAQLVASSQKAKEVLGWSPKFTNVKDIIKDAWKWHETHPNG 326 *************************************99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (329 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.35 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory